Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (89.03kD).)

Mouse anti-Human Zyxin Monoclonal Antibody | anti-ZYX antibody

Zyxin (ZYX, ZYX Protein, ESP 2, ESP2, HED 2, HED2, Zyxin 2) (HRP)

Gene Names
ZYX; ESP-2; HED-2
Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Zyxin; Monoclonal Antibody; Zyxin (ZYX; ZYX Protein; ESP 2; ESP2; HED 2; HED2; Zyxin 2) (HRP); anti-ZYX antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2C10-4A7
Specificity
Recognizes human ZYX.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-ZYX antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-573 from ZYX (AAH08743) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAAPRPSPAISVSVSAPAFYAPQKKFGPVVAPKPKVNPFRPGDSEPPPAPGAQRAQMGRVGEIPPPPPEDFPLPPPPLAGDGDDAEGALGGAFPPPPPPIEESFPPAPLEEEIFPSPPPPPEEEGGPEAPIPPPPQPREKVSSIDLEIDSLSSLLDDMTKNDPFKARVSSGYVPPPVATPFSSKSSTKPAAGGTAPLPPWKSPSSSQPLPQVPAPAQSQTQFHVQPQPQPKPQVQLHVQSQTQPVSLANTQPRGP
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (89.03kD).)

Western Blot (WB) (Western Blot detection against Immunogen (89.03kD).)

Western Blot (WB)

(Western Blot analysis of ZYX expression in transfected 293T cell line by ZYX monoclonal antibody Lane 1: ZYX transfected lysate (61.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ZYX expression in transfected 293T cell line by ZYX monoclonal antibody Lane 1: ZYX transfected lysate (61.3kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ZYX on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to ZYX on HeLa cell. [antibody concentration 10ug/ml])

Immunoprecipitation (IP)

(Immunoprecipitation of ZYX transfected lysate using ZYX monoclonal antibody and Protein A Magnetic Bead and immunoblotted with ZYX rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of ZYX transfected lysate using ZYX monoclonal antibody and Protein A Magnetic Bead and immunoblotted with ZYX rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged ZYX is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ZYX is 1ng/ml as a capture antibody.)
Related Product Information for anti-ZYX antibody
This gene is a member of the zyxin family and encodes a protein with three LIM zinc-binding domains. This protein localizes to focal adhesion sites and along actin stress fibers. Recruitment of this protein to the plasma membrane occurs in a lysophosphatidic acid (LPA)-dependent manner and it regulates LPA-induced cell migration. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized.
Product Categories/Family for anti-ZYX antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
45,075 Da
NCBI Official Full Name
Homo sapiens zyxin, mRNA
NCBI Official Synonym Full Names
zyxin
NCBI Official Symbol
ZYX
NCBI Official Synonym Symbols
ESP-2; HED-2
NCBI Protein Information
zyxin
Protein Family

NCBI Description

Focal adhesions are actin-rich structures that enable cells to adhere to the extracellular matrix and at which protein complexes involved in signal transduction assemble. Zyxin is a zinc-binding phosphoprotein that concentrates at focal adhesions and along the actin cytoskeleton. Zyxin has an N-terminal proline-rich domain and three LIM domains in its C-terminal half. The proline-rich domain may interact with SH3 domains of proteins involved in signal transduction pathways while the LIM domains are likely involved in protein-protein binding. Zyxin may function as a messenger in the signal transduction pathway that mediates adhesion-stimulated changes in gene expression and may modulate the cytoskeletal organization of actin bundles. Alternative splicing results in multiple transcript variants that encode the same isoform. [provided by RefSeq, Jul 2008]

Research Articles on ZYX

Similar Products

Product Notes

The ZYX (Catalog #AAA6155930) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Zyxin (ZYX, ZYX Protein, ESP 2, ESP2, HED 2, HED2, Zyxin 2) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Zyxin can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ZYX for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Zyxin, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.