Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged ZSCAN4 is 0.3ng/ml as a capture antibody)

Mouse anti-Human ZSCAN4 Monoclonal Antibody | anti-ZSCAN4 antibody

ZSCAN4 (Zinc Finger and SCAN Domain-containing Protein 4, Zinc Finger Protein 494, ZNF494) APC

Gene Names
ZSCAN4; ZNF494
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ZSCAN4; Monoclonal Antibody; ZSCAN4 (Zinc Finger and SCAN Domain-containing Protein 4; Zinc Finger Protein 494; ZNF494) APC; anti-ZSCAN4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2C7
Specificity
Recognizes human ZSCAN4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-ZSCAN4 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa3-100 from human ZSCAN4 (NP_689890) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LDLRTIFQCEPSENNLGSENSAFQQSQGPAVQREEGISEFSRMVLNSFQDSNNSYARQELQRLYRIFHSWLQPEKHSKDEIISLLVLEQFMIGGHCND
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged ZSCAN4 is 0.3ng/ml as a capture antibody)

Testing Data (Detection limit for recombinant GST tagged ZSCAN4 is 0.3ng/ml as a capture antibody)
Product Categories/Family for anti-ZSCAN4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48,957 Da
NCBI Official Full Name
zinc finger and SCAN domain-containing protein 4
NCBI Official Synonym Full Names
zinc finger and SCAN domain containing 4
NCBI Official Symbol
ZSCAN4
NCBI Official Synonym Symbols
ZNF494
NCBI Protein Information
zinc finger and SCAN domain-containing protein 4; zinc finger protein 494
UniProt Protein Name
Zinc finger and SCAN domain-containing protein 4
UniProt Gene Name
ZSCAN4
UniProt Synonym Gene Names
ZNF494
UniProt Entry Name
ZSCA4_HUMAN

NCBI Description

The ZSCAN4 gene encodes a protein involved in telomere maintenance and with a key role in the critical feature of mouse embryonic stem (ES) cells, namely, defying cellular senescence and maintaining normal karyotype for many cell divisions in culture (Zalzman et al., 2010 [PubMed 20336070]).[supplied by OMIM, May 2010]

Uniprot Description

ZSCAN4: Embryonic stem (ES) cell-specific transcription factor required to regulate ES cell pluripotency. Binds telomeres and plays a key role in genomic stability in ES cells by regulating telomere elongation. Acts as an activator of spontaneous telomere sister chromatid exchange (T-SCE) and telomere elongation in undifferentiated ES cells.

Protein type: C2H2-type zinc finger protein; Transcription factor

Chromosomal Location of Human Ortholog: 19q13.43

Cellular Component: nuclear chromosome, telomeric region

Molecular Function: DNA binding; metal ion binding; transcription factor activity

Biological Process: regulation of transcription, DNA-dependent; transcription, DNA-dependent

Similar Products

Product Notes

The ZSCAN4 zscan4 (Catalog #AAA6140016) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ZSCAN4 (Zinc Finger and SCAN Domain-containing Protein 4, Zinc Finger Protein 494, ZNF494) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ZSCAN4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ZSCAN4 zscan4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ZSCAN4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.