Mouse anti-Human ZNRD1 Monoclonal Antibody | anti-ZNRD1 antibody

ZNRD1 (DNA-directed RNA Polymerase I Subunit RPA12, Zinc Ribbon Domain-containing Protein 1, RPA12, MGC13376)

Cat. Num. AAA6009865

• Gene Names: ZNRD1; TEX6; ZR14; Rpa12; hZR14; HTEX-6; tctex-6
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: ZNRD1; Monoclonal Antibody; ZNRD1 (DNA-directed RNA Polymerase I Subunit RPA12; Zinc Ribbon Domain-containing Protein 1; RPA12; MGC13376); Anti -ZNRD1 (DNA-directed RNA Polymerase I Subunit RPA12; anti-ZNRD1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 6C12
• Specificity: Recognizes human ZNRD1.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: GSVLPLPGAQDTVTCIRCGFNINVRDFEGKVVKTSVVFHQLGTAMPMSVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCTNCKFQEKEDS

• Applicable Applications for anti-ZNRD1 antibody: ELISA (EL/EIA), Western Blot (WB)
• Application Notes: Suitable for use in ELISA and Western Blot.
• Immunogen: Partial recombinant corresponding to aa24-127 from human ZNRD1 (NP_055411) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.44kD).)

Western Blot (WB)

(Western Blot analysis of ZNRD1 expression in transfected 293T cell line by ZNRD1 monoclonal antibody.|Lane 1: ZNRD1 transfected lysate (13.9kD).|Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged ZNRD1 is 0.1ng/ml as a capture antibody.)

Related Product Information for anti-ZNRD1 antibody

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase I which synthesizes ribosomal RNA precursors.

Product Categories/Family for anti-ZNRD1 antibody

Antibodies; Abs to Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 48146335
• NCBI GeneID: 30834
• UniProt Accession #: Q9P1U0
• Molecular Weight: 13,904 Da
• NCBI Official Full Name: ZNRD1
• NCBI Official Synonym Full Names: zinc ribbon domain containing 1
• NCBI Official Symbol: ZNRD1
• NCBI Official Synonym Symbols: TEX6; ZR14; Rpa12; hZR14; HTEX-6; tctex-6
• NCBI Protein Information: DNA-directed RNA polymerase I subunit RPA12; transcription-associated zinc ribbon protein; RNA polymerase I small specific subunit Rpa12
• UniProt Protein Name: DNA-directed RNA polymerase I subunit RPA12
• UniProt Gene Name: ZNRD1
• UniProt Synonym Gene Names: RPA12
• UniProt Entry Name: RPA12_HUMAN

NCBI Description

This gene encodes a DNA-directed RNA polymerase I subunit. The encoded protein contains two potential zinc-binding motifs and may play a role in regulation of cell proliferation. The encoded protein may be involved in cancer and human immunodeficiency virus progression. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]

Uniprot Description

ZNRD1: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase I which synthesizes ribosomal RNA precursors. Belongs to the archaeal RpoM/eukaryotic RPA12/RPB9/RPC11 RNA polymerase family.

Protein type: Transferase; Transcription initiation complex; Nucleolus

Chromosomal Location of Human Ortholog: 6p21.3

Cellular Component: nucleoplasm; DNA-directed RNA polymerase I complex

Molecular Function: nucleic acid binding; zinc ion binding

Biological Process: negative regulation of gene expression, epigenetic; nucleobase, nucleoside, nucleotide and nucleic acid metabolic process; RNA elongation from RNA polymerase I promoter; transcription from RNA polymerase I promoter; gene expression; transcription initiation from RNA polymerase I promoter; termination of RNA polymerase I transcription; regulation of gene expression, epigenetic