Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human ZNF7 Monoclonal Antibody | anti-ZNF7 antibody

ZNF7 (Zinc Finger Protein 7, HF.16, KOX4, zf30, Zinc Finger Protein HF.16, Zinc Finger Protein KOX4) (Biotin)

Gene Names
ZNF7; KOX4; zf30; HF.16
Reactivity
Human
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ZNF7; Monoclonal Antibody; ZNF7 (Zinc Finger Protein 7; HF.16; KOX4; zf30; Zinc Finger Protein HF.16; Zinc Finger Protein KOX4) (Biotin); anti-ZNF7 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
6F2
Specificity
Recognizes human ZNF7.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-ZNF7 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa67-166 of human ZNF7 (NP_003407) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DLQGAEGTEAPRTSKTDSTIRTENEQACEDMDILKSESYGTVVRISPQDFPQNPGFGDVSDSEVWLDSHLGSPGLKVTGFTFQNNCLNEETVVPKTFTK*
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ZNF7 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to ZNF7 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged ZNF7 is 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ZNF7 is 0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-ZNF7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16,352 Da
NCBI Official Full Name
zinc finger protein 7 isoform 2
NCBI Official Synonym Full Names
zinc finger protein 7
NCBI Official Symbol
ZNF7
NCBI Official Synonym Symbols
KOX4; zf30; HF.16
NCBI Protein Information
zinc finger protein 7; C2-H2 type zinc finger protein; Zinc finger protein-7 (KOX4); zinc finger protein 7 (KOX 4, clone HF.16); zinc finger protein HF.16; zinc finger protein KOX4; zinc finger protein zfp30
UniProt Protein Name
Zinc finger protein 7
UniProt Gene Name
ZNF7
UniProt Synonym Gene Names
KOX4
UniProt Entry Name
ZNF7_HUMAN

Similar Products

Product Notes

The ZNF7 znf7 (Catalog #AAA6145299) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ZNF7 (Zinc Finger Protein 7, HF.16, KOX4, zf30, Zinc Finger Protein HF.16, Zinc Finger Protein KOX4) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF7 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ZNF7 znf7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ZNF7, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.