Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to ZNF496 on NIH/3T3 cell. [antibody concentration 10 ug/ml])

Mouse ZNF496 Monoclonal Antibody | anti-ZNF496 antibody

ZNF496 (Zinc Finger Protein 496, MGC15548, NIZP1, ZKSCAN17) (APC)

Gene Names
ZNF496; NIZP1; ZFP496; ZSCAN49; ZKSCAN17
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified
Synonyms
ZNF496; Monoclonal Antibody; ZNF496 (Zinc Finger Protein 496; MGC15548; NIZP1; ZKSCAN17) (APC); Zinc Finger Protein 496; ZKSCAN17; anti-ZNF496 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2B3
Specificity
Recognizes ZNF496.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-ZNF496 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
ZNF496 (NP_116141, 485aa-585aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
HLQPDRLQPVEKREQAASEDADKGPKEPLENGKAKLSFQCCECGKAFQRHDHLARHRSHFHLKDKARPFQCRYCVKSFTQNYDLLRHERLHMKRRSKQALN
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ZNF496 on NIH/3T3 cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to ZNF496 on NIH/3T3 cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ZNF496 on NIH/3T3 cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to ZNF496 on NIH/3T3 cell. [antibody concentration 10 ug/ml])

Western Blot (WB)

(ZNF496 monoclonal antibody (M08), clone 2B3 Western Blot analysis of ZNF496 expression in NIH/3T3.)

Western Blot (WB) (ZNF496 monoclonal antibody (M08), clone 2B3 Western Blot analysis of ZNF496 expression in NIH/3T3.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to ZNF496 on formalin-fixed paraffin-embedded human cholangiocarcinoma. [antibody concentration 1.5 ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to ZNF496 on formalin-fixed paraffin-embedded human cholangiocarcinoma. [antibody concentration 1.5 ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to ZNF496 on formalin-fixed paraffin-embedded human cholangiocarcinoma. [antibody concentration 1.5 ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to ZNF496 on formalin-fixed paraffin-embedded human cholangiocarcinoma. [antibody concentration 1.5 ug/ml])
Related Product Information for anti-ZNF496 antibody
Mouse monoclonal antibody raised against a partial recombinant ZNF496.
Product Categories/Family for anti-ZNF496 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
67kDa
NCBI Official Full Name
zinc finger protein 496 isoform 1
NCBI Official Synonym Full Names
zinc finger protein 496
NCBI Official Symbol
ZNF496
NCBI Official Synonym Symbols
NIZP1; ZFP496; ZSCAN49; ZKSCAN17
NCBI Protein Information
zinc finger protein 496
UniProt Protein Name
Zinc finger protein 496
Protein Family
UniProt Gene Name
ZNF496
UniProt Synonym Gene Names
ZKSCAN17
UniProt Entry Name
ZN496_HUMAN

Uniprot Description

ZNF496: DNA-binding transcription factor that can both act as an activator and a repressor. Belongs to the krueppel C2H2-type zinc-finger protein family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: C2H2-type zinc finger protein; DNA-binding

Chromosomal Location of Human Ortholog: 1q44

Cellular Component: nuclear body; nucleus

Molecular Function: protein binding; DNA binding; protein self-association; metal ion binding

Biological Process: transcription from RNA polymerase II promoter; positive regulation of transcription, DNA-dependent; negative regulation of transcription from RNA polymerase II promoter

Research Articles on ZNF496

Similar Products

Product Notes

The ZNF496 znf496 (Catalog #AAA6166349) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's ZNF496 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ZNF496 znf496 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ZNF496, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.