Mouse anti-Human ZNF238 Monoclonal Antibody | anti-ZNF238 antibody
ZNF238 (Zinc Finger Protein 238, Zinc Finger and BTB Domain-containing Protein 18, ZBTB18, 58kD Repressor Protein, RP58, Transcriptional Repressor RP58, Translin-associated Zinc Finger Protein 1, TAZ1, TAZ-1, Zinc Finger Protein C2H2-171) (MaxLight 405)
Gene Names
ZBTB18; RP58; MRD22; TAZ-1; ZNF238; C2H2-171
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ZNF238; Monoclonal Antibody; ZNF238 (Zinc Finger Protein 238; Zinc Finger and BTB Domain-containing Protein 18; ZBTB18; 58kD Repressor Protein; RP58; Transcriptional Repressor RP58; Translin-associated Zinc Finger Protein 1; TAZ1; TAZ-1; Zinc Finger Protein C2H2-171) (MaxLight 405); anti-ZNF238 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4E4
Specificity
Recognizes human ZNF238.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Sequence Length
3851
Applicable Applications for anti-ZNF238 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa182-281 from ZNF238 (NP_991331) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KRDLAAEPGNMWMRLPSDSAGIPQAGGEAEPHATAAGKTVASPCSSTESLSQRSVTSVRDSADVDCVLDLSVKSSLSGVENLNSSYFSSQDVLRSNLVQV
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-ZNF238 antibody
MaxLight405 is a new Violet photostable dye conjugate comparable to Alexa Fluor 405, PacificBlue, Brilliant Violet 421 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (400nm); Emission (423nm); Extinction Coefficient 32,000.
Product Categories/Family for anti-ZNF238 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
Homo sapiens zinc finger and BTB domain containing 18 (ZBTB18), transcript variant 1, mRNA
NCBI Official Synonym Full Names
zinc finger and BTB domain containing 18
NCBI Official Symbol
ZBTB18
NCBI Official Synonym Symbols
RP58; MRD22; TAZ-1; ZNF238; C2H2-171
NCBI Protein Information
zinc finger and BTB domain-containing protein 18
NCBI Description
This gene encodes a C2H2-type zinc finger protein which acts a transcriptional repressor of genes involved in neuronal development. The encoded protein recognizes a specific sequence motif and recruits components of chromatin to target genes. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2013]
Research Articles on ZNF238
Similar Products
Product Notes
The ZNF238 (Catalog #AAA6193517) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ZNF238 (Zinc Finger Protein 238, Zinc Finger and BTB Domain-containing Protein 18, ZBTB18, 58kD Repressor Protein, RP58, Transcriptional Repressor RP58, Translin-associated Zinc Finger Protein 1, TAZ1, TAZ-1, Zinc Finger Protein C2H2-171) (MaxLight 405) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF238 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ZNF238 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ZNF238, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
