Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.01kD).)

Mouse anti-Human ZNF101 Monoclonal Antibody | anti-ZNF101 antibody

ZNF101 (Zinc Finger Protein 101, Zinc Finger Protein HZF12) (Biotin)

Gene Names
ZNF101; HZF12
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ZNF101; Monoclonal Antibody; ZNF101 (Zinc Finger Protein 101; Zinc Finger Protein HZF12) (Biotin); anti-ZNF101 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2D5
Specificity
Recognizes human ZNF101.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-ZNF101 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
ELISA: 0.1ng/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa112-202 from human ZNF101 (NP_149981) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LRHSFLDRHMRAHAGHKRSECGGEWRETPRKQKQHGKASISPSSGARRTVTPTRKRPYECKVCGKAFNSPNLFQIHQRTHTGKRSYKCRE
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.01kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.01kD).)

Western Blot (WB)

(Western Blot analysis of ZNF101 expression in transfected 293T cell line by ZNF101 monoclonal antibody. Lane 1: ZNF101 transfected lysate (36.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ZNF101 expression in transfected 293T cell line by ZNF101 monoclonal antibody. Lane 1: ZNF101 transfected lysate (36.5kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged ZNF101 is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ZNF101 is 0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-ZNF101 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50,339 Da
NCBI Official Full Name
zinc finger protein 101
NCBI Official Synonym Full Names
zinc finger protein 101
NCBI Official Symbol
ZNF101
NCBI Official Synonym Symbols
HZF12
NCBI Protein Information
zinc finger protein 101; zinc finger protein 12; zinc finger protein HZF12; zinc finger protein 101 (Y2)
UniProt Protein Name
Zinc finger protein 101
Protein Family
UniProt Gene Name
ZNF101
UniProt Entry Name
ZN101_HUMAN

NCBI Description

Zinc finger proteins (ZNFs), such as ZNF101, bind nucleic acids and perform many key functions, the most important of which is regulating transcription (summary by Bellefroid et al., 1993 [PubMed 8467795]). See ZNF91 (MIM 603971) for general information on ZNFs.[supplied by OMIM, Nov 2010]

Uniprot Description

ZNF101: May be involved in transcriptional regulation. Belongs to the krueppel C2H2-type zinc-finger protein family.

Protein type: C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 19p13.11

Cellular Component: nucleus

Molecular Function: DNA binding; metal ion binding

Biological Process: regulation of transcription, DNA-dependent; transcription, DNA-dependent

Similar Products

Product Notes

The ZNF101 znf101 (Catalog #AAA6145236) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ZNF101 (Zinc Finger Protein 101, Zinc Finger Protein HZF12) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF101 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). ELISA: 0.1ng/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ZNF101 znf101 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ZNF101, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.