Mouse ZIC3 Monoclonal Antibody | anti-ZIC3 antibody

ZIC3 (Zic Family Member 3 (odd-Paired Homolog, Drosophila), HTX, HTX1, ZNF203) (PE)

Cat. Num. AAA6185597

• Gene Names: ZIC3; HTX; HTX1; ZNF203; VACTERLX
• Applications: Immunofluorescence, Western Blot
• Purity: Purified
• Synonyms: ZIC3; Monoclonal Antibody; ZIC3 (Zic Family Member 3 (odd-Paired Homolog; Drosophila); HTX; HTX1; ZNF203) (PE); Zic Family Member 3 (odd-Paired Homolog; ZNF203; anti-ZIC3 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2G1
• Specificity: Recognizes ZIC3.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-ZIC3 antibody: Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: ZIC3 (NP_003404.1, 182aa-274aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: NQVHLGLRGELFGRADPYRPVASPRTDPYAAGAQFPNYSPMNMNMGVNVAAHHGPGAFFRYMRQPIKQELSCKWIDEAQLSRPKKSCDRTFST
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ZIC3 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ZIC3 on HeLa cell. [antibody concentration 10 ug/ml])

Related Product Information for anti-ZIC3 antibody

This gene encodes a member of the ZIC family of C2H2-type zinc finger proteins. This nuclear protein probably functions as a transcription factor in early stages of left-right body axis formation. Mutations in this gene cause X-linked visceral heterotaxy, which includes congenital heart disease and left-right axis defects in organs. [provided by RefSeq]

Product Categories/Family for anti-ZIC3 antibody

Antibodies; Transcription Factors; Zinc (Ring) Finger

NCBI and Uniprot Product Information

• NCBI GI #: 4507973
• NCBI GeneID: 7547
• NCBI Accession #: NP_003404.1
• NCBI GenBank Nucleotide #: NM_003413.3
• UniProt Accession #: O60481; Q14DE5; Q5JY75; B2CNW4
• Molecular Weight: 50,045 Da
• NCBI Official Full Name: zinc finger protein ZIC 3
• NCBI Official Synonym Full Names: Zic family member 3
• NCBI Official Symbol: ZIC3
• NCBI Official Synonym Symbols: HTX; HTX1; ZNF203; VACTERLX
• NCBI Protein Information: zinc finger protein ZIC 3; heterotaxy 1; zinc finger protein 203; zinc finger protein of the cerebellum 3; Zic family member 3 (odd-paired homolog, Drosophila)
• UniProt Protein Name: Zinc finger protein ZIC 3
• Protein Family: Zinc finger protein
• UniProt Gene Name: ZIC3
• UniProt Synonym Gene Names: ZNF203
• UniProt Entry Name: ZIC3_HUMAN

NCBI Description

This gene encodes a member of the ZIC family of C2H2-type zinc finger proteins. This nuclear protein probably functions as a transcription factor in early stages of left-right body axis formation. Mutations in this gene cause X-linked visceral heterotaxy, which includes congenital heart disease and left-right axis defects in organs. [provided by RefSeq, Jul 2008]

Uniprot Description

ZIC3: Acts as transcriptional activator. Required in the earliest stages in both axial midline development and left-right (LR) asymmetry specification. Binds to the minimal GLI-consensus sequence 5'-GGGTGGTC-3'. Defects in ZIC3 are the cause of visceral heterotaxy X- linked type 1 (HTX1). A form of visceral heterotaxy, a complex disorder due to disruption of the normal left-right asymmetry of the thoracoabdominal organs. It results in an abnormal arrangement of visceral organs, and a wide variety of congenital defects. Clinical features of visceral heterotaxy X- linked type 1 include dextrocardia, corrected transposition of great arteries, ventricular septal defect, patent ductus arteriosus, pulmonic stenosis, situs inversus viscerum, and asplenia and/or polysplenia. Defects in ZIC3 are a cause of VACTERL association X- linked with or without hydrocephalus (VACTERLX). A syndrome characterized by vertebral anomalies, anal atresia, cardiac malformations, tracheoesophageal fistula, renal anomalies (urethral atresia with hydronephrosis), and limb anomalies (hexadactyly, humeral hypoplasia, radial aplasia, and proximally placed thumb). Some patients may have hydrocephalus. Some cases of VACTERL-H are associated with increased chromosome breakage and rearrangement. Belongs to the GLI C2H2-type zinc-finger protein family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; C2H2-type zinc finger protein; Transcription factor

Chromosomal Location of Human Ortholog: Xq26.2

Cellular Component: nucleoplasm; cytoplasm; nucleus

Molecular Function: protein binding; sequence-specific DNA binding; metal ion binding; transcription factor activity

Biological Process: anterior/posterior pattern formation; transcription, DNA-dependent; somatic stem cell maintenance; positive regulation of transcription, DNA-dependent; positive regulation of transcription from RNA polymerase II promoter; heart looping; determination of left/right symmetry; lung development

Disease: Vacterl Association, X-linked, With Or Without Hydrocephalus; Heterotaxy, Visceral, 1, X-linked