Mouse anti-Human ZFYVE16 Monoclonal Antibody | anti-ZFYVE16 antibody

ZFYVE16 (Zinc Finger FYVE Domain-containing Protein 16, Endofin, Endosome-associated FYVE Domain Protein, KIAA0305, PPP1R69) (FITC)

Cat. Num. AAA6150526

• Gene Names: ZFYVE16; PPP1R69
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ZFYVE16; Monoclonal Antibody; ZFYVE16 (Zinc Finger FYVE Domain-containing Protein 16; Endofin; Endosome-associated FYVE Domain Protein; KIAA0305; PPP1R69) (FITC); anti-ZFYVE16 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 4B9
• Specificity: Recognizes human ZFYVE16.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
• Sequence Length: 10751

• Applicable Applications for anti-ZFYVE16 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-100 from ZFYVE16 (NP_055548) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MDSYFKAAVSDLDKLLDDFEQNPDEQDYLQDVQNAYDSNHCSVSSELASSQRTSLLPKDQECVNSCASSETSYGTNESSLNEKTLKGLTSIQNEKNVTGL
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD))

Western Blot (WB)

(Western Blot analysis of ZFYVE16 expression in transfected 293T cell line by ZFYVE16 monoclonal antibody Lane 1: ZFYVE16 transfected lysate (88.4kD). Lane 2: Non-transfected lysate. )

Testing Data

(Detection limit for recombinant GST tagged ZFYVE16 is ~0.3ng/ml as a capture antibody.)

Product Categories/Family for anti-ZFYVE16 antibody

Antibodies; Transcription Factors; Zinc (Ring) Finger

NCBI and Uniprot Product Information

• NCBI GI #: 1676319192
• NCBI GeneID: 9765
• NCBI Accession #: NM_014733.6
• NCBI GenBank Nucleotide #: NM_014733
• UniProt Accession #: Q7Z3T8
• NCBI Official Full Name: Homo sapiens zinc finger FYVE-type containing 16 (ZFYVE16), transcript variant 1, mRNA
• NCBI Official Synonym Full Names: zinc finger FYVE-type containing 16
• NCBI Official Symbol: ZFYVE16
• NCBI Official Synonym Symbols: PPP1R69
• NCBI Protein Information: zinc finger FYVE domain-containing protein 16
• UniProt Protein Name: Zinc finger FYVE domain-containing protein 16
• Protein Family: Zinc finger FYVE domain-containing protein
• UniProt Gene Name: ZFYVE16
• UniProt Synonym Gene Names: KIAA0305
• UniProt Entry Name: ZFY16_HUMAN

NCBI Description

This gene encodes an endosomal protein that belongs to the FYVE zinc finger family of proteins. The encoded protein is thought to regulate membrane trafficking in the endosome. This protein functions as a scaffold protein in the transforming growth factor-beta signaling pathway and is involved in positive and negative feedback regulation of the bone morphogenetic protein signaling pathway. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2013]

Uniprot Description

endofin: May be involved in regulating membrane trafficking in the endosomal pathway. Overexpression induces endosome aggregation. Required to target TOM1 to endosomes. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Lipid-binding

Chromosomal Location of Human Ortholog: 5q14

Cellular Component: intracellular membrane-bound organelle; early endosome membrane; early endosome; cytoplasm

Molecular Function: protein binding; phosphatidylinositol-3,4,5-triphosphate binding; metal ion binding; protein transporter activity; phosphatidylinositol binding

Biological Process: BMP signaling pathway; protein targeting to lysosome; vesicle organization and biogenesis; regulation of endocytosis; signal transduction; endosome transport