Western Blot (WB)
(ZFYVE16 monoclonal antibody (M04), clone 2E2. Western Blot analysis of ZFYVE16 expression in HepG2.)
Mouse ZFYVE16 Monoclonal Antibody | anti-ZFYVE16 antibody
ZFYVE16 (Zinc Finger, FYVE Domain Containing 16, DKFZp686E13162, ENDOFIN, KIAA0305) (APC)
Applications
Western Blot
Purity
Purified
Synonyms
ZFYVE16; Monoclonal Antibody; ZFYVE16 (Zinc Finger; FYVE Domain Containing 16; DKFZp686E13162; ENDOFIN; KIAA0305) (APC); Zinc Finger; KIAA0305; anti-ZFYVE16 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
200
Specificity
Recognizes ZFYVE16.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
1539
Applicable Applications for anti-ZFYVE16 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
ZFYVE16 (NP_055548, 1aa-100aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MDSYFKAAVSDLDKLLDDFEQNPDEQDYLQDVQNAYDSNHCSVSSELASSQRTSLLPKDQECVNSCASSETSYGTNESSLNEKTLKGLTSIQNEKNVTGL
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(ZFYVE16 monoclonal antibody (M04), clone 2E2. Western Blot analysis of ZFYVE16 expression in HepG2.)
Western Blot (WB)
(ZFYVE16 monoclonal antibody (M04), clone 2E2. Western Blot analysis of ZFYVE16 expression in HepG2.)
Testing Data
(Detection limit for recombinant GST tagged ZFYVE16 is 1 ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged ZFYVE16 is 1 ng/ml as a capture antibody.)
Related Product Information for anti-ZFYVE16 antibody
The ZFYVE16 gene encodes endofin, an endosomal protein implicated in regulating membrane trafficking. It is characterized by the presence of a phosphatidylinositol 3-phosphate-binding FYVE domain positioned in the middle of the molecule (Seet et al., 2004 [PubMed 14613930]). [supplied by OMIM]
Product Categories/Family for anti-ZFYVE16 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
zinc finger FYVE domain-containing protein 16 isoform a
Protein Family
Similar Products
Product Notes
The ZFYVE16 (Catalog #AAA6169204) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's ZFYVE16 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ZFYVE16 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ZFYVE16, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
