Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.7kD).)

Mouse anti-Human ZFHX3 Monoclonal Antibody | anti-ZFHX3 antibody

ZFHX3 (Zinc Finger Homeobox Protein 3, AT Motif-binding Factor, AT-binding Transcription Factor 1, Alpha-fetoprotein Enhancer-binding Protein, Zinc Finger Homeodomain Protein 3, ZFH-3, ATBF1) (AP)

Gene Names
ZFHX3; ATBT; ATBF1; ZFH-3; ZNF927; C16orf47
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ZFHX3; Monoclonal Antibody; ZFHX3 (Zinc Finger Homeobox Protein 3; AT Motif-binding Factor; AT-binding Transcription Factor 1; Alpha-fetoprotein Enhancer-binding Protein; Zinc Finger Homeodomain Protein 3; ZFH-3; ATBF1) (AP); anti-ZFHX3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3B1
Specificity
Recognizes human ZFHX3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
3703
Applicable Applications for anti-ZFHX3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa2811-2910 from human ZFHX3 (NP_008816) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EDFESPSMSSVNLNFDQTKLDNDDCSSVNTAITDTTTGDEGNADNDSATGIATETKSSSAPNEGLTKAAMMAMSEYEDRLSSGLVSPAPSFYSKEYDNEG
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.7kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.7kD).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ZFHX3 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to ZFHX3 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged ZFHX3 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ZFHX3 is ~0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-ZFHX3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
463
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
zinc finger homeobox protein 3 isoform A
NCBI Official Synonym Full Names
zinc finger homeobox 3
NCBI Official Symbol
ZFHX3
NCBI Official Synonym Symbols
ATBT; ATBF1; ZFH-3; ZNF927; C16orf47
NCBI Protein Information
zinc finger homeobox protein 3
UniProt Protein Name
Zinc finger homeobox protein 3
UniProt Gene Name
ZFHX3
UniProt Synonym Gene Names
ATBF1; ZFH-3
UniProt Entry Name
ZFHX3_HUMAN

NCBI Description

This gene encodes a transcription factor with multiple homeodomains and zinc finger motifs, and regulates myogenic and neuronal differentiation. The encoded protein suppresses expression of the alpha-fetoprotein gene by binding to an AT-rich enhancer motif. The protein has also been shown to negatively regulate c-Myb, and transactivate the cell cycle inhibitor cyclin-dependent kinase inhibitor 1A (also known as p21CIP1). This gene is reported to function as a tumor suppressor in several cancers, and sequence variants of this gene are also associated with atrial fibrillation. Multiple transcript variants expressed from alternate promoters and encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009]

Uniprot Description

ATBF1: Transcriptional repressor. It inhibits the enhancer element of the AFP gene by binding to its AT-rich core sequence. Regulator of myoblasts differentiation through the binding to the AT-rich sequence of MYF6 promoter and promoter repression. Down- regulates the MUC5AC promoter in gastric cancer. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell development/differentiation; Mitochondrial; DNA-binding; C2H2-type zinc finger protein; Transcription factor

Chromosomal Location of Human Ortholog: 16q22.3

Cellular Component: nucleoplasm; transcription factor complex; mitochondrion; intracellular membrane-bound organelle; nucleolus; nucleus

Molecular Function: RNA polymerase II transcription factor activity, enhancer binding; enzyme binding; zinc ion binding; sequence-specific DNA binding; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; muscle development; regulation of transcription, DNA-dependent; regulation of neuron differentiation; brain development; negative regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; cell cycle arrest; negative regulation of myoblast differentiation; positive regulation of myoblast differentiation

Disease: Prostate Cancer

Research Articles on ZFHX3

Similar Products

Product Notes

The ZFHX3 zfhx3 (Catalog #AAA6134612) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ZFHX3 (Zinc Finger Homeobox Protein 3, AT Motif-binding Factor, AT-binding Transcription Factor 1, Alpha-fetoprotein Enhancer-binding Protein, Zinc Finger Homeodomain Protein 3, ZFH-3, ATBF1) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ZFHX3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ZFHX3 zfhx3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ZFHX3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.