Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human WWTR1 Monoclonal Antibody | anti-WWTR1 antibody

WWTR1 (WW Domain-containing Transcription Regulator Protein 1, Transcriptional Coactivator with PDZ-binding Motif, TAZ) (HRP)

Gene Names
WWTR1; TAZ
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
WWTR1; Monoclonal Antibody; WWTR1 (WW Domain-containing Transcription Regulator Protein 1; Transcriptional Coactivator with PDZ-binding Motif; TAZ) (HRP); anti-WWTR1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1F1
Specificity
Recognizes human WWTR1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
5037
Applicable Applications for anti-WWTR1 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa201-300 from human WWTR1 (NP_056287) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PSTLSQQNHPTQNPPAGLMSMPNALTTQQQQQQKLRLQRIQMERERIRMRQEELMRQEAALCRQLPMEAETLAPVQAAVNPPTMTPDMRSITNNSSDPFL*
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to WWTR1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to WWTR1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged WWTR1 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged WWTR1 is 0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-WWTR1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens WW domain containing transcription regulator 1 (WWTR1), transcript variant 1, mRNA
NCBI Official Synonym Full Names
WW domain containing transcription regulator 1
NCBI Official Symbol
WWTR1
NCBI Official Synonym Symbols
TAZ
NCBI Protein Information
WW domain-containing transcription regulator protein 1
UniProt Protein Name
WW domain-containing transcription regulator protein 1
UniProt Gene Name
WWTR1
UniProt Synonym Gene Names
TAZ
UniProt Entry Name
WWTR1_HUMAN

Uniprot Description

TAZ: Transcriptional coactivator which acts as a downstream regulatory target in the Hippo signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. WWTR1 enhances PAX8 and NKX2-1/TTF1-dependent gene activation. Regulates the nuclear accumulation of SMADS and has a key role in coupling them to the transcriptional machinery such as the mediator complex. Regulates embryonic stem-cell self-renewal, promotes cell proliferation and epithelial-mesenchymal transition. Binds to SLC9A3R2 via the PDZ motif at the plasma membrane. Binds to YWHAZ in vivo and in vitro through the phosphoserine-binding motif RSHSSP. Interacts (via coiled-coil domain) with SMAD2 (via MH1 domain), SMAD3 and SMAD4. Interacts with MED15, PAX8 and NKX2-1. Interacts with TEAD1, TEAD2, TEAD3 and TEAD4. Highly expressed in kidney, heart, placenta and lung. Expressed in the thyroid tissue.

Protein type: Oncoprotein; Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 3q23-q24

Cellular Component: nucleoplasm; transcription factor complex; cytoplasm; cytosol; nucleus

Molecular Function: protein binding; protein homodimerization activity; transcription coactivator activity; transcription corepressor activity

Biological Process: transcription initiation from RNA polymerase II promoter; SCF-dependent proteasomal ubiquitin-dependent protein catabolic process; transcription, DNA-dependent; stem cell division; multicellular organism growth; protein ubiquitination; negative regulation of transcription from RNA polymerase II promoter; negative regulation of fat cell differentiation; glomerulus development; osteoblast differentiation; mesenchymal cell differentiation; regulation of transcription, DNA-dependent; negative regulation of protein amino acid phosphorylation; transforming growth factor beta receptor signaling pathway; positive regulation of cell proliferation; negative regulation of protein kinase activity; gene expression; positive regulation of transcription from RNA polymerase II promoter

Research Articles on WWTR1

Similar Products

Product Notes

The WWTR1 wwtr1 (Catalog #AAA6155791) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The WWTR1 (WW Domain-containing Transcription Regulator Protein 1, Transcriptional Coactivator with PDZ-binding Motif, TAZ) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's WWTR1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the WWTR1 wwtr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "WWTR1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.