Mouse WT1 Monoclonal Antibody | anti-WT1 antibody

WT1 (Wilms Tumor 1, GUD, WAGR, WIT-2, WT33) (HRP)

Cat. Num. AAA6180280

• Gene Names: WT1; GUD; AWT1; WAGR; WT33; NPHS4; WIT-2
• Applications: ELISA, Immunofluorescence
• Purity: Purified
• Synonyms: WT1; Monoclonal Antibody; WT1 (Wilms Tumor 1; GUD; WAGR; WIT-2; WT33) (HRP); Wilms Tumor 1; WT33; anti-WT1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 1A12
• Specificity: Recognizes WT1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-WT1 antibody: ELISA (EIA), Immunofluorescence (IF)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: WT1 (NP_000369.3, 349aa-439aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: QDVRRVPGVAPTLVRSASETSEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTC
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to WT1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to WT1 on HeLa cell. [antibody concentration 10 ug/ml])

Product Categories/Family for anti-WT1 antibody

Antibodies; Cancer Markers

NCBI and Uniprot Product Information

• NCBI GI #: 65507714
• NCBI GeneID: 7490
• NCBI Accession #: NP_000369.3
• NCBI GenBank Nucleotide #: NM_000378.4
• UniProt Accession #: P19544; Q15881; Q16256; Q16575; Q4VXV4; Q4VXV5; Q4VXV6; Q8IYZ5; A8K6S1; B3KSA5
• Molecular Weight: 49188 MW
• NCBI Official Full Name: Wilms tumor protein isoform A
• NCBI Official Synonym Full Names: Wilms tumor 1
• NCBI Official Symbol: WT1
• NCBI Official Synonym Symbols: GUD; AWT1; WAGR; WT33; NPHS4; WIT-2
• NCBI Protein Information: Wilms tumor protein
• UniProt Protein Name: Wilms tumor protein
• Protein Family: Wilms tumor protein
• UniProt Gene Name: WT1
• UniProt Entry Name: WT1_HUMAN

NCBI Description

This gene encodes a transcription factor that contains four zinc-finger motifs at the C-terminus and a proline/glutamine-rich DNA-binding domain at the N-terminus. It has an essential role in the normal development of the urogenital system, and it is mutated in a small subset of patients with Wilms tumor. This gene exhibits complex tissue-specific and polymorphic imprinting pattern, with biallelic, and monoallelic expression from the maternal and paternal alleles in different tissues. Multiple transcript variants have been described. In several variants, there is evidence for the use of a non-AUG (CUG) translation initiation codon upstream of, and in-frame with the first AUG. Authors of PMID:7926762 also provide evidence that WT1 mRNA undergoes RNA editing in human and rat, and that this process is tissue-restricted and developmentally regulated. [provided by RefSeq, Mar 2015]

Uniprot Description

WT1: a DNA binding protein and apparent transcriptional regulator. Recognizes and binds to the DNA sequence 5'-CGCCCCCGC-3'. Expressed in the kidney and a subset of hematopoietic cells. Defects in WT1 are the cause of Wilms tumor 1 (WT1), an embryonal malignancy of the kidney that affects approximately 1 in 10'000 infants and young children. It occurs both in sporadic and hereditary forms. Four alternatively spliced isoforms have been described.

Protein type: Transcription factor; DNA-binding; Tumor suppressor; Nucleolus; C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 11p13

Cellular Component: nucleoplasm; cytoplasm; nucleolus; nuclear speck; nucleus

Molecular Function: protein binding; zinc ion binding; RNA binding; sequence-specific DNA binding; transcription factor activity

Biological Process: tissue development; gonad development; positive regulation of apoptosis; heart development; positive regulation of transcription, DNA-dependent; thorax and anterior abdomen determination; negative regulation of transcription from RNA polymerase II promoter; glomerulus development; germ cell development; negative regulation of cell proliferation; regulation of transcription, DNA-dependent; epithelial cell differentiation; ureteric bud development; male genitalia development; kidney development; vasculogenesis; camera-type eye development; transcription, DNA-dependent; adrenal gland development; RNA splicing; male gonad development; glomerular basement membrane development; regulation of transcription from RNA polymerase II promoter; sex determination; ureteric bud branching; negative regulation of translation; positive regulation of transcription from RNA polymerase II promoter; negative regulation of cell growth; negative regulation of transcription, DNA-dependent; negative regulation of apoptosis

Disease: Wilms Tumor, Aniridia, Genitourinary Anomalies, And Mental Retardation Syndrome; Denys-drash Syndrome; Mesothelioma, Malignant; Nephrotic Syndrome, Type 4; Frasier Syndrome; Aniridia; Wilms Tumor 1; Meacham Syndrome