Mouse anti-Human WSB1 Monoclonal Antibody | anti-WSB1 antibody

WSB1 (WD Repeat and SOCS Box-containing Protein 1, WSB-1, SOCS Box-containing WD Protein, SWIP1, SWiP-1)

Cat. Num. AAA6013374

• Gene Names: WSB1; SWIP1; WSB-1
• Reactivity: Human
• Applications: ELISA
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: WSB1; Monoclonal Antibody; WSB1 (WD Repeat and SOCS Box-containing Protein 1; WSB-1; SOCS Box-containing WD Protein; SWIP1; SWiP-1); Anti -WSB1 (WD Repeat and SOCS Box-containing Protein 1; anti-WSB1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3E10
• Specificity: Recognizes human WSB1.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: QGHRTVKLVPWSQCLQNFLLHGTKNVTNSSSLRLPRQNSDGGQKNKPREHIIDCGDIVWSLAFGSSVPEKQSRCVNIEWHRFRFG*

• Applicable Applications for anti-WSB1 antibody: ELISA (EL/EIA)
• Application Notes: Suitable for use in ELISA.; Dilution: ELISA: 10ng/ml
• Immunogen: Partial recombinant corresponding to aa53-138 from human WSB1 (AAH21110) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged WSB1 is 10ng/ml as a capture antibody.)

Product Categories/Family for anti-WSB1 antibody

Antibodies; Abs to Ubiquitin

NCBI and Uniprot Product Information

• NCBI GI #: 20143912
• NCBI GeneID: 26118
• NCBI Accession #: NP_599027.1
• NCBI GenBank Nucleotide #: NM_134265.2
• UniProt Accession #: Q9Y6I7; Q9NRB1; Q9UBH9; Q9UG25; Q9UNN6
• Molecular Weight: 47,432 Da
• NCBI Official Full Name: WD repeat and SOCS box-containing protein 1 isoform 2
• NCBI Official Synonym Full Names: WD repeat and SOCS box containing 1
• NCBI Official Symbol: WSB1
• NCBI Official Synonym Symbols: SWIP1; WSB-1
• NCBI Protein Information: WD repeat and SOCS box-containing protein 1; WD repeat and SOCS box-containing 1; SOCS box-containing WD protein SWiP-1
• UniProt Protein Name: WD repeat and SOCS box-containing protein 1
• Protein Family: WD repeat and SOCS box-containing protein
• UniProt Gene Name: WSB1
• UniProt Synonym Gene Names: SWIP1; WSB-1
• UniProt Entry Name: WSB1_HUMAN

NCBI Description

This gene encodes a member of the WD-protein subfamily. This protein shares a high sequence identity to mouse and chick proteins. It contains several WD-repeats spanning most of the protein and an SOCS box in the C-terminus. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

WSB1: Probable substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Recognizes type II iodothyronine deiodinase/DIO2. Confers constitutive instability to HIPK2 through proteasomal degradation. 3 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 17q11.1

Cellular Component: intracellular

Molecular Function: protein binding

Biological Process: protein ubiquitination