Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Immunohistochemistry analysis in formalin fixed and paraffin-embedded human placenta using 135400 (3ug/ml) followed by peroxidase conjugation to the secondary antibody and DAB staining.)

Mouse anti-Human WNT5A Monoclonal Antibody | anti-WNT5A antibody

WNT5A (Wingless-type MMTV Integration Site Family Member 5A, Protein Wnt-5a, hWNT5A) (AP)

Gene Names
WNT5A; hWNT5A
Reactivity
Human
Applications
ELISA, Immunohistochemistry
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
WNT5A; Monoclonal Antibody; WNT5A (Wingless-type MMTV Integration Site Family Member 5A; Protein Wnt-5a; hWNT5A) (AP); anti-WNT5A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3A4
Specificity
Recognizes human WNT5A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-WNT5A antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa201-300 from human WNT5A (AAH64694) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ERERIHAKGSYESARILMNLHNNEAGRRTVYNLADVACKCHGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLV
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunohistochemistry (IHC)

(Immunohistochemistry analysis in formalin fixed and paraffin-embedded human placenta using 135400 (3ug/ml) followed by peroxidase conjugation to the secondary antibody and DAB staining.)

Immunohistochemistry (IHC) (Immunohistochemistry analysis in formalin fixed and paraffin-embedded human placenta using 135400 (3ug/ml) followed by peroxidase conjugation to the secondary antibody and DAB staining.)
Product Categories/Family for anti-WNT5A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
40,887 Da
NCBI Official Full Name
Homo sapiens wingless-type MMTV integration site family, member 5A, mRNA
NCBI Official Synonym Full Names
Wnt family member 5A
NCBI Official Symbol
WNT5A
NCBI Official Synonym Symbols
hWNT5A
NCBI Protein Information
protein Wnt-5a
Protein Family

NCBI Description

The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene encodes a member of the WNT family that signals through both the canonical and non-canonical WNT pathways. This protein is a ligand for the seven transmembrane receptor frizzled-5 and the tyrosine kinase orphan receptor 2. This protein plays an essential role in regulating developmental pathways during embryogenesis. This protein may also play a role in oncogenesis. Mutations in this gene are the cause of autosomal dominant Robinow syndrome. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jan 2012]

Research Articles on WNT5A

Similar Products

Product Notes

The WNT5A (Catalog #AAA6134575) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The WNT5A (Wingless-type MMTV Integration Site Family Member 5A, Protein Wnt-5a, hWNT5A) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's WNT5A can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the WNT5A for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "WNT5A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.