Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (32.3kD).)

Mouse anti-Human WFDC3 Monoclonal Antibody | anti-WFDC3 antibody

WFDC3 (WAP Four-disulfide Core Domain Protein 3, Putative Protease Inhibitor WAP14, dJ447F3.3)

Gene Names
WFDC3; WAP14; dJ447F3.3
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
WFDC3; Monoclonal Antibody; WFDC3 (WAP Four-disulfide Core Domain Protein 3; Putative Protease Inhibitor WAP14; dJ447F3.3); Anti -WFDC3 (WAP Four-disulfide Core Domain Protein 3; anti-WFDC3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
5C12
Specificity
Recognizes human WFDC3.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MDENCQAGEKCCKSGCGRFCVPPVLPPKLTMNPNWTVRSDSELEIPVP
Applicable Applications for anti-WFDC3 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Dilution: ELISA: 0.1ng/ml
Immunogen
Full length recombinant protein corresponding to aa1-48 from human WFDC3 (AAH26014) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (32.3kD).)

Western Blot (WB) (Western Blot detection against Immunogen (32.3kD).)

Testing Data

(Detection limit for recombinant GST tagged WFDC3 is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged WFDC3 is 0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-WFDC3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
24,687 Da
NCBI Official Full Name
WFDC3 protein
NCBI Official Synonym Full Names
WAP four-disulfide core domain 3
NCBI Official Symbol
WFDC3
NCBI Official Synonym Symbols
WAP14; dJ447F3.3
NCBI Protein Information
WAP four-disulfide core domain protein 3; whey acidic protein 14; protease inhibitor WAP14; putative protease inhibitor WAP14
UniProt Protein Name
WAP four-disulfide core domain protein 3
UniProt Gene Name
WFDC3
UniProt Synonym Gene Names
WAP14
UniProt Entry Name
WFDC3_HUMAN

NCBI Description

This gene encodes a member of the WAP-type four-disulfide core (WFDC) domain family. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. The encoded protein contains four WFDC domains. Most WFDC genes are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the telomeric cluster. Alternatively spliced transcript variants have been observed but their full-length nature has not been determined. [provided by RefSeq, Jul 2008]

Uniprot Description

WFDC3:

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 20q13.12

Cellular Component: extracellular region

Molecular Function: serine-type endopeptidase inhibitor activity

Similar Products

Product Notes

The WFDC3 wfdc3 (Catalog #AAA644339) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The WFDC3 (WAP Four-disulfide Core Domain Protein 3, Putative Protease Inhibitor WAP14, dJ447F3.3) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's WFDC3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Dilution: ELISA: 0.1ng/ml. Researchers should empirically determine the suitability of the WFDC3 wfdc3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MDENCQAGEK CCKSGCGRFC VPPVLPPKLT MNPNWTVRSD SELEIPVP. It is sometimes possible for the material contained within the vial of "WFDC3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.