Mouse anti-Human WFDC3 Monoclonal Antibody | anti-WFDC3 antibody

WFDC3 (WAP Four-disulfide Core Domain Protein 3, Putative Protease Inhibitor WAP14, dJ447F3.3) (Biotin)

Cat. Num. AAA6145175

• Gene Names: WFDC3; WAP14; dJ447F3.3
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: WFDC3; Monoclonal Antibody; WFDC3 (WAP Four-disulfide Core Domain Protein 3; Putative Protease Inhibitor WAP14; dJ447F3.3) (Biotin); anti-WFDC3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 5C12
• Specificity: Recognizes human WFDC3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 778

• Applicable Applications for anti-WFDC3 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: ELISA: 0.1ng/ml; Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant protein corresponding to aa1-48 from human WFDC3 (AAH26014) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MDENCQAGEKCCKSGCGRFCVPPVLPPKLTMNPNWTVRSDSELEIPVP
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (32.3kD).)

Testing Data

(Detection limit for recombinant GST tagged WFDC3 is 0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-WFDC3 antibody

Antibodies; Protease Inhibitors

NCBI and Uniprot Product Information

• NCBI GI #: 19684138
• NCBI GeneID: 140686
• NCBI Official Full Name: Homo sapiens WAP four-disulfide core domain 3, mRNA
• NCBI Official Synonym Full Names: WAP four-disulfide core domain 3
• NCBI Official Symbol: WFDC3
• NCBI Official Synonym Symbols: WAP14; dJ447F3.3
• NCBI Protein Information: WAP four-disulfide core domain protein 3
• Protein Family: WAP four-disulfide core domain protein

NCBI Description

This gene encodes a member of the WAP-type four-disulfide core (WFDC) domain family. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. The encoded protein contains four WFDC domains. Most WFDC genes are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the telomeric cluster. Alternatively spliced transcript variants have been observed but their full-length nature has not been determined. [provided by RefSeq, Jul 2008]