Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged WDR5 is 0.3 ng/ml as a capture antibody.)

Mouse WDR5 Monoclonal Antibody | anti-WDR5 antibody

WDR5 (WD Repeat Domain 5, BIG-3, SWD3) (FITC)

Gene Names
WDR5; SWD3; BIG-3; CFAP89
Applications
ELISA
Purity
Purified
Synonyms
WDR5; Monoclonal Antibody; WDR5 (WD Repeat Domain 5; BIG-3; SWD3) (FITC); WD Repeat Domain 5; SWD3; anti-WDR5 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1B1
Specificity
Recognizes WDR5.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-WDR5 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
WDR5 (NP_060058, 16aa-120aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QPTPSSSATQSKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGK
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged WDR5 is 0.3 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged WDR5 is 0.3 ng/ml as a capture antibody.)
Related Product Information for anti-WDR5 antibody
This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 7 WD repeats. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq]
Product Categories/Family for anti-WDR5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36,588 Da
NCBI Official Full Name
WD repeat-containing protein 5
NCBI Official Synonym Full Names
WD repeat domain 5
NCBI Official Symbol
WDR5
NCBI Official Synonym Symbols
SWD3; BIG-3; CFAP89
NCBI Protein Information
WD repeat-containing protein 5; WD-repeat protein 5; BMP2-induced 3-kb gene protein; SWD3, Set1c WD40 repeat protein, homolog; cilia and flagella associated protein 89
UniProt Protein Name
WD repeat-containing protein 5
UniProt Gene Name
WDR5
UniProt Synonym Gene Names
BIG3
UniProt Entry Name
WDR5_HUMAN

NCBI Description

This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 7 WD repeats. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

WDR5: a WD40 repeat protein. May accelerate osteoblast differentiation. Interacts with HCFC1. WD40 repeats are found in a number of eukaryotic proteins that coordinate multi-protein complex assemblies. WD40 proteins are implicated in many functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 9q34

Cellular Component: nucleoplasm; histone methyltransferase complex; nucleus; histone acetyltransferase complex

Molecular Function: protein binding; histone lysine N-methyltransferase activity (H3-K4 specific); histone acetyltransferase activity (H4-K16 specific)

Biological Process: establishment and/or maintenance of chromatin architecture; transcription, DNA-dependent; histone H3-K4 methylation; skeletal development

Research Articles on WDR5

Similar Products

Product Notes

The WDR5 wdr5 (Catalog #AAA6177409) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's WDR5 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the WDR5 wdr5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "WDR5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.