Mouse anti-Human WDR4 Monoclonal Antibody | anti-WDR4 antibody

WDR4 (WD Repeat-containing Protein 4, tRNA (Guanine-N(7)-)-methyltransferase Subunit WDR4, TRM82, TRMT82) (AP)

Cat. Num. AAA6134563

• Gene Names: WDR4; TRM82; TRMT82
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: WDR4; Monoclonal Antibody; WDR4 (WD Repeat-containing Protein 4; tRNA (Guanine-N(7)-)-methyltransferase Subunit WDR4; TRM82; TRMT82) (AP); anti-WDR4 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1F9
• Specificity: Recognizes human WDR4.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-WDR4 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 1ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-266 from human WDR4 (AAH01074) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MLLDVAVSPDDRFILTADRDEKIRVSWAAAPHSIESFCLGHTEFVSRISVVPTQPGLLLSSSGDGTLRLWEYRSGRQLHCCHLASLQELVDPQAPQKFAASRIAFWCQENCVALLCDGTSVVYIFQLDARRQQLVYRQQLAFQHQVWDVAFEETQGLWVLQDCQEAPLVLYRPVGDQWQSVPESTVLKKVSGVLRGNWAMLEGSAGADASFSSLYKATFDNVTSYLKKKEERLQQQLEKKQRRRSPPPGPDGHAKKMRPGEATLSC
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (55.37kD).)

Western Blot (WB)

(WDR4 monoclonal antibody Western Blot analysis of WDR4 expression in HeLa NE.)

Western Blot (WB)

(Western Blot analysis of WDR4 expression in transfected 293T cell line by WDR4 monoclonal antibody Lane 1: WDR4 transfected lysate (45.5kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to WDR4 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 1ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged WDR4 is ~1ng/ml as a capture antibody.)

Product Categories/Family for anti-WDR4 antibody

Antibodies; WD Repeat Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 33875953
• NCBI GeneID: 10785
• Molecular Weight: 29,946 Da
• NCBI Official Full Name: Homo sapiens WD repeat domain 4, mRNA
• NCBI Official Synonym Full Names: WD repeat domain 4
• NCBI Official Symbol: WDR4
• NCBI Official Synonym Symbols: TRM82; TRMT82
• NCBI Protein Information: tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit WDR4
• Protein Family: tRNA

NCBI Description

This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is excluded as a candidate for a form of nonsyndromic deafness (DFNB10), but is still a candidate for other disorders mapped to 21q22.3 as well as for the development of Down syndrome phenotypes. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, May 2012]