Mouse anti-Human WASL Monoclonal Antibody | anti-WASL antibody

WASL (Neural Wiskott-Aldrich Syndrome Protein, NWASP, N-WASP) APC

Cat. Num. AAA6139858

• Gene Names: WASL; NWASP; WASPB; N-WASP
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: WASL; Monoclonal Antibody; WASL (Neural Wiskott-Aldrich Syndrome Protein; NWASP; N-WASP) APC; anti-WASL antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 5F4
• Specificity: Recognizes human WASL.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-WASL antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa97-185 from human WASL (NP_003932) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: NFVYNSPRGYFHTFAGDTCQVALNFANEEEAKKFRKAVTDLLGRRQRKSEKRRDPPNGPNLPMATVDIKNPEITTNRFYGPQVNNISH
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(WASL monoclonal antibody, Western Blot analysis of WASL expression in IMR-32.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to WASL on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 0.8ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to WASL on HeLa cell. [antibody concentration 10ug/ml].)

Product Categories/Family for anti-WASL antibody

Antibodies; Disease Markers

NCBI and Uniprot Product Information

• NCBI GI #: 51702526
• NCBI GeneID: 8976
• NCBI Accession #: NP_003932
• NCBI GenBank Nucleotide #: NM_003941
• UniProt Accession #: O00401
• Molecular Weight: 55 kDa
• NCBI Official Full Name: neural Wiskott-Aldrich syndrome protein
• NCBI Official Synonym Full Names: WASP like actin nucleation promoting factor
• NCBI Official Symbol: WASL
• NCBI Official Synonym Symbols: NWASP; WASPB; N-WASP
• NCBI Protein Information: neural Wiskott-Aldrich syndrome protein
• UniProt Protein Name: Neural Wiskott-Aldrich syndrome protein
• Protein Family: Neural Wiskott-Aldrich syndrome protein
• UniProt Gene Name: WASL
• UniProt Synonym Gene Names: N-WASP
• UniProt Entry Name: WASL_HUMAN

NCBI Description

This gene encodes a member of the Wiskott-Aldrich syndrome (WAS) protein family. Wiskott-Aldrich syndrome proteins share similar domain structure, and associate with a variety of signaling molecules to alter the actin cytoskeleton. The encoded protein is highly expressed in neural tissues, and interacts with several proteins involved in cytoskeletal organization, including cell division control protein 42 (CDC42) and the actin-related protein-2/3 (ARP2/3) complex. The encoded protein may be involved in the formation of long actin microspikes, and in neurite extension. [provided by RefSeq, Jul 2013]