Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against immunogen using 135321 (38.28kD).)

Mouse anti-Human WAS Monoclonal Antibody | anti-WAS antibody

WAS (Wiskott-Aldrich Syndrome Protein, WASp, IMD2, SCNX, THC, THC1) APC

Gene Names
WAS; THC; IMD2; SCNX; THC1; WASP; WASPA
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
WAS; Monoclonal Antibody; WAS (Wiskott-Aldrich Syndrome Protein; WASp; IMD2; SCNX; THC; THC1) APC; anti-WAS antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3H5
Specificity
Recognizes human WAS.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-WAS antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa57-170 from human WAS with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LPPGAEHWTKEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLVYSTPTPFFHTFAGDDCQAGLNFADEDEAQAFRALVQEKIQKRNQRQSGDRRQLPPPPTPANEER
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against immunogen using 135321 (38.28kD).)

Western Blot (WB) (Western Blot detection against immunogen using 135321 (38.28kD).)
Product Categories/Family for anti-WAS antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55kDa
NCBI Official Full Name
wiskott-Aldrich syndrome protein
NCBI Official Synonym Full Names
WASP actin nucleation promoting factor
NCBI Official Symbol
WAS
NCBI Official Synonym Symbols
THC; IMD2; SCNX; THC1; WASP; WASPA
NCBI Protein Information
wiskott-Aldrich syndrome protein
UniProt Protein Name
Wiskott-Aldrich syndrome protein
Protein Family
UniProt Gene Name
WAS
UniProt Synonym Gene Names
IMD2; WASp
UniProt Entry Name
WASP_HUMAN

NCBI Description

The Wiskott-Aldrich syndrome (WAS) family of proteins share similar domain structure, and are involved in transduction of signals from receptors on the cell surface to the actin cytoskeleton. The presence of a number of different motifs suggests that they are regulated by a number of different stimuli, and interact with multiple proteins. Recent studies have demonstrated that these proteins, directly or indirectly, associate with the small GTPase, Cdc42, known to regulate formation of actin filaments, and the cytoskeletal organizing complex, Arp2/3. Wiskott-Aldrich syndrome is a rare, inherited, X-linked, recessive disease characterized by immune dysregulation and microthrombocytopenia, and is caused by mutations in the WAS gene. The WAS gene product is a cytoplasmic protein, expressed exclusively in hematopoietic cells, which show signalling and cytoskeletal abnormalities in WAS patients. A transcript variant arising as a result of alternative promoter usage, and containing a different 5' UTR sequence, has been described, however, its full-length nature is not known. [provided by RefSeq, Jul 2008]

Uniprot Description

WASP: a member of the Wiskott-Aldrich syndrome (WAS) family of proteins. A cytoplasmic protein expressed exclusively in hematopoietic cells. Transduces signals from surface receptors to the actin cytoskeleton. Associates with the small GTPase, Cdc42, known to regulate formation of actin filaments, and the cytoskeletal organizing complex, Arp2/3. Mutated in Wiskott-Aldrich syndrome, a rare, inherited, X-linked, recessive disease characterized by immune dysregulation and microthrombocytopenia.

Protein type: Adaptor/scaffold; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: Xp11.4-p11.21

Cellular Component: vesicle membrane; intercellular junction; cytosol; actin cytoskeleton

Molecular Function: identical protein binding; protein binding; phospholipase binding; actin binding; SH3 domain binding; protein kinase binding

Biological Process: epidermis development; T cell activation; actin filament-based movement; defense response; endosome transport; T cell receptor signaling pathway; actin filament polymerization; regulation of catalytic activity; actin polymerization and/or depolymerization; innate immune response; protein complex assembly; immune response; blood coagulation

Disease: Thrombocytopenia 1; Neutropenia, Severe Congenital, X-linked

Research Articles on WAS

Similar Products

Product Notes

The WAS was (Catalog #AAA6139856) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The WAS (Wiskott-Aldrich Syndrome Protein, WASp, IMD2, SCNX, THC, THC1) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's WAS can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the WAS was for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "WAS, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.