Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human VPS11 Monoclonal Antibody | anti-VPS11 antibody

VPS11 (Vacuolar Protein Sorting-associated Protein 11 Homolog, hVPS11, RING Finger Protein 108, RNF108, PP3476, END1, PEP5) APC

Gene Names
VPS11; END1; PEP5; RNF108; hVPS11
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
VPS11; Monoclonal Antibody; VPS11 (Vacuolar Protein Sorting-associated Protein 11 Homolog; hVPS11; RING Finger Protein 108; RNF108; PP3476; END1; PEP5) APC; anti-VPS11 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1H1
Specificity
Recognizes human VPS11.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-VPS11 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa842-942 from human VPS11 (NP_068375) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
FHQHCFESYSESDADCPTCLPENRKVMDMIRAQEQKRDLHDQFQHQLRCSNDSFSVIADYFGRGVFNKLTLLTDPPTARLTSSLEAGLQRDLLMHSRRGT
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(VPS11 monoclonal antibody, Western Blot analysis of VPS11 expression in K-562.)

Western Blot (WB) (VPS11 monoclonal antibody, Western Blot analysis of VPS11 expression in K-562.)
Product Categories/Family for anti-VPS11 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
107,837 Da
NCBI Official Full Name
vacuolar protein sorting-associated protein 11 homolog isoform 1
NCBI Official Synonym Full Names
vacuolar protein sorting 11 homolog (S. cerevisiae)
NCBI Official Symbol
VPS11
NCBI Official Synonym Symbols
END1; PEP5; RNF108; hVPS11
NCBI Protein Information
vacuolar protein sorting-associated protein 11 homolog; RING finger protein 108
UniProt Protein Name
Vacuolar protein sorting-associated protein 11 homolog
UniProt Gene Name
VPS11
UniProt Synonym Gene Names
RNF108; hVPS11
UniProt Entry Name
VPS11_HUMAN

Uniprot Description

VPS11: May play a role in vesicle-mediated protein trafficking to lysosomal compartments and in membrane docking/fusion reactions of late endosomes/lysosomes. Belongs to the VPS11 family.

Protein type: Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 11q23

Cellular Component: late endosome membrane; lysosome; endocytic vesicle; lysosomal membrane; late endosome; endosome

Molecular Function: protein binding; syntaxin binding; zinc ion binding; nucleotide binding

Biological Process: vesicle-mediated transport; intracellular protein transport

Similar Products

Product Notes

The VPS11 vps11 (Catalog #AAA6139842) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The VPS11 (Vacuolar Protein Sorting-associated Protein 11 Homolog, hVPS11, RING Finger Protein 108, RNF108, PP3476, END1, PEP5) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's VPS11 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the VPS11 vps11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "VPS11, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.