Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human VPREB3 Monoclonal Antibody | anti-VPREB3 antibody

VPREB3 (Pre-B Lymphocyte Protein 3, Protein VPreB3, N27C7-2, UNQ355/PRO619, 8HS20) (MaxLight 650)

Gene Names
VPREB3; 8HS20; N27C7-2
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
VPREB3; Monoclonal Antibody; VPREB3 (Pre-B Lymphocyte Protein 3; Protein VPreB3; N27C7-2; UNQ355/PRO619; 8HS20) (MaxLight 650); anti-VPREB3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4H8
Specificity
Recognizes human VPREB3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-VPREB3 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa24-124 from human VPREB3 (NP_037510) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QLDALLVFPGQVAQLSCTLSPQHVTIRDYGVSWYQQRAGSAPRYLLYYRSEEDHHRPADIPDRFSAAKDEAHNACVLTISPVQPEDDADYYCSVGYGFSP*
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-VPREB3 antibody
MaxLight650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor647, DyLight649, Cy5 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000.
Product Categories/Family for anti-VPREB3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
13kDa
NCBI Official Full Name
pre-B lymphocyte protein 3
NCBI Official Synonym Full Names
V-set pre-B cell surrogate light chain 3
NCBI Official Symbol
VPREB3
NCBI Official Synonym Symbols
8HS20; N27C7-2
NCBI Protein Information
pre-B lymphocyte protein 3
UniProt Protein Name
Pre-B lymphocyte protein 3
Protein Family
UniProt Gene Name
VPREB3

NCBI Description

The protein encoded by this gene is the human ortholog of the mouse VpreB3 (8HS20) protein, is thought to be involved in B-cell maturation, and may play a role in assembly of the pre-B cell receptor (pre-BCR). While the role of this protein in B-cell development has not yet been elucidated, studies with the chicken ortholog of this protein have found that when overexpressed, this protein localizes to the endoplasmic reticulum. The mouse ortholog of this protein has been shown to associate with membrane mu heavy chains early in the course of pre-B cell receptor biosynthesis. Expression of this gene has been observed in some lymphomas. [provided by RefSeq, Apr 2015]

Uniprot Description

VPREB3: Associates with the Ig-mu chain to form a molecular complex that is expressed on the surface of pre-B-cells. Belongs to the immunoglobulin superfamily.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 22q11.23|22q11

Cellular Component: endoplasmic reticulum; extracellular region; extracellular space

Biological Process: immune response; immunoglobulin production; leukocyte migration

Research Articles on VPREB3

Similar Products

Product Notes

The VPREB3 vpreb3 (Catalog #AAA6225427) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The VPREB3 (Pre-B Lymphocyte Protein 3, Protein VPreB3, N27C7-2, UNQ355/PRO619, 8HS20) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's VPREB3 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the VPREB3 vpreb3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "VPREB3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.