Mouse anti-Human VAMP5 Monoclonal Antibody | anti-VAMP5 antibody

VAMP5 (Vesicle-associated Membrane Protein 5, VAMP-5, Myobrevin, HSPC191) (Biotin)

Cat. Num. AAA6145118

• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: VAMP5; Monoclonal Antibody; VAMP5 (Vesicle-associated Membrane Protein 5; VAMP-5; Myobrevin; HSPC191) (Biotin); anti-VAMP5 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3D4
• Specificity: Recognizes human VAMP5.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-VAMP5 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-70 from human VAMP5 (NP_006625) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MAGIELERCQQQANEVTEIMRNNFGKVLERGVKLAELQQRSDQLLDMSSTFNKTTQNLAQKKCWENIRYR
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (33.81kD).)

Testing Data

(Detection limit for recombinant GST tagged VAMP5 is 0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-VAMP5 antibody

Antibodies; Neuroscience

NCBI and Uniprot Product Information

• NCBI GI #: 5730112
• NCBI GeneID: 10791
• NCBI Accession #: NP_006625
• NCBI GenBank Nucleotide #: NM_006634
• UniProt Accession #: O95183; Q9P0T2
• Molecular Weight: 12.7 kDa (109 aa), confirmed by MALDI-TOF.
• NCBI Official Full Name: vesicle-associated membrane protein 5
• NCBI Official Synonym Full Names: vesicle associated membrane protein 5
• NCBI Official Symbol: VAMP5
• NCBI Protein Information: vesicle-associated membrane protein 5
• UniProt Protein Name: Vesicle-associated membrane protein 5
• Protein Family: Vesicle-associated membrane protein
• UniProt Gene Name: VAMP5
• UniProt Synonym Gene Names: VAMP-5
• UniProt Entry Name: VAMP5_HUMAN

NCBI Description

Synaptobrevins/VAMPs, syntaxins, and the 25-kD synaptosomal-associated protein are the main components of a protein complex involved in the docking and/or fusion of vesicles and cell membranes. The VAMP5 gene is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family and the SNARE superfamily. This VAMP family member may participate in vesicle trafficking events that are associated with myogenesis. [provided by RefSeq, Jul 2008]

Uniprot Description

VAMP5: May participate in trafficking events that are associated with myogenesis, such as myoblast fusion and/or GLUT4 trafficking. Belongs to the synaptobrevin family.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 2p11.2

Cellular Component: SNARE complex; synaptic vesicle; cytoplasmic vesicle membrane; cell surface; perinuclear region of cytoplasm; integral to plasma membrane; late endosome; plasma membrane; trans-Golgi network

Molecular Function: SNAP receptor activity; SNARE binding

Biological Process: vesicle fusion; muscle development; skeletal muscle development; exocytosis; neurotransmitter secretion; Golgi to plasma membrane protein transport; cell differentiation