Western Blot (WB)
(Western Blot detection against Immunogen (35.79kD).)
Mouse anti-Human USP9Y Monoclonal Antibody | anti-USP9Y antibody
USP9Y (Probable Ubiquitin Carboxyl-terminal Hydrolase FAF-Y, Deubiquitinating Enzyme FAF-Y, Fat Facets Protein-related, Y-linked, Ubiquitin Thioesterase FAF-Y, Ubiquitin-specific Protease 9, Y Chromosome, Ubiquitin-specific-processing Protease FAF-Y, DFFR
Gene Names
USP9Y; DFFRY; SPGFY2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
USP9Y; Monoclonal Antibody; USP9Y (Probable Ubiquitin Carboxyl-terminal Hydrolase FAF-Y; Deubiquitinating Enzyme FAF-Y; Fat Facets Protein-related; Y-linked; Ubiquitin Thioesterase FAF-Y; Ubiquitin-specific Protease 9; Y Chromosome; Ubiquitin-specific-processing Protease FAF-Y; DFFR; anti-USP9Y antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2D3
Specificity
Recognizes human USP9Y.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-USP9Y antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa3-91 from USP9Y (NP_004645) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AITHGSPVGGNDSQGQVLDGQSQHLFQQNQTSSPDSSNENSVATPPPEEQGQGDAPPQHEDEEPAFPHTELANLDDMINRPRWVVPVL*
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (35.79kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (35.79kD).)
Testing Data
(Detection limit for recombinant GST tagged USP9Y is ~1ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged USP9Y is ~1ng/ml as a capture antibody.)
Related Product Information for anti-USP9Y antibody
May function as a ubiquitin-protein or polyubiquitin hydrolase involved both in the processing of ubiquitin precursors and of ubiquitinated proteins. May therefore play an important role regulatory role at the level of protein turnover by preventing degradation of proteins through the removal of conjugated ubiquitin. Essential component of TGF-beta/BMP signaling cascade. Deubiquitinates monoubiquitinated SMAD4, opposing the activity of E3 ubiquitin-protein ligase TRIM33. Monoubiquitination of SMAD4 hampers its ability to form a stable complex with activated SMAD2/3 resulting in inhibition of TGF-beta/BMP signaling cascade. Deubiqitination of SMAD4 by USP9X re-empowers its competence to mediate TGF-beta signaling.
Product Categories/Family for anti-USP9Y antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
291kDa
NCBI Official Full Name
probable ubiquitin carboxyl-terminal hydrolase FAF-Y
NCBI Official Synonym Full Names
ubiquitin specific peptidase 9 Y-linked
NCBI Official Symbol
USP9Y
NCBI Official Synonym Symbols
DFFRY; SPGFY2
NCBI Protein Information
probable ubiquitin carboxyl-terminal hydrolase FAF-Y
UniProt Protein Name
Probable ubiquitin carboxyl-terminal hydrolase FAF-Y
Protein Family
UniProt Gene Name
USP9Y
UniProt Synonym Gene Names
DFFRY
UniProt Entry Name
USP9Y_HUMAN
NCBI Description
This gene is a member of the peptidase C19 family. It encodes a protein that is similar to ubiquitin-specific proteases, which cleave the ubiquitin moiety from ubiquitin-fused precursors and ubiquitinylated proteins. [provided by RefSeq, Mar 2009]
Research Articles on USP9Y
1. This is the first research investigating the utility of TTTY15-USP9Y in prostate cancer detection
Similar Products
Product Notes
The USP9Y usp9y (Catalog #AAA6134505) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The USP9Y (Probable Ubiquitin Carboxyl-terminal Hydrolase FAF-Y, Deubiquitinating Enzyme FAF-Y, Fat Facets Protein-related, Y-linked, Ubiquitin Thioesterase FAF-Y, Ubiquitin-specific Protease 9, Y Chromosome, Ubiquitin-specific-processing Protease FAF-Y, DFFR reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's USP9Y can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the USP9Y usp9y for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "USP9Y, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
