Mouse anti-Human USP52 Monoclonal Antibody | anti-Pan2 antibody

USP52 (Inactive Ubiquitin Carboxyl-terminal Hydrolase 52, PAB-dependent Poly(A)-specific Ribonuclease Subunit 2, PAN2, hPan2, KIAA0710)

Cat. Num. AAA642296

• Gene Names: Pan2; Usp52; AI047843; AW742773; mKIAA0710; 1200014O24Rik
• Reactivity: Human
• Applications: ELISA, Western Blot, Immunofluorescence
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: USP52; Monoclonal Antibody; USP52 (Inactive Ubiquitin Carboxyl-terminal Hydrolase 52; PAB-dependent Poly(A)-specific Ribonuclease Subunit 2; PAN2; hPan2; KIAA0710); Anti -USP52 (Inactive Ubiquitin Carboxyl-terminal Hydrolase 52; anti-Pan2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 6A7
• Specificity: Recognizes human USP52.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: TVYLFHMPRKRMISLRFLAWYFLDLKIQGETHDSIEDARTALQLYRKYLELSKNGTEPESFHKVLKGLYEKGRKMDWKVPEPEGQTSPKNAAVFSSVLAL

• Applicable Applications for anti-Pan2 antibody: ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF)
• Application Notes: Suitable for use in ELISA, Immunofluorescence and Western Blot.; Dilution: Immunofluorescence: 10ug/ml
• Immunogen: Partial recombinant corresponding to aa1099-1198 from USP52 (NP_055686) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PAN2 on HeLa cell . [antibody concentration 10ug/ml])

Product Categories/Family for anti-Pan2 antibody

Antibodies; Abs to Ubiquitin

NCBI and Uniprot Product Information

• NCBI GI #: 51259008
• NCBI GeneID: 103135
• UniProt Accession #: Q8BGF7; Q3TZK5; Q68FH6; Q6ZQ63
• Molecular Weight: 135,253 Da
• NCBI Official Full Name: Usp52 protein
• NCBI Official Synonym Full Names: PAN2 polyA specific ribonuclease subunit homolog (S. cerevisiae)
• NCBI Official Symbol: Pan2
• NCBI Official Synonym Symbols: Usp52; AI047843; AW742773; mKIAA0710; 1200014O24Rik
• NCBI Protein Information: PAB-dependent poly(A)-specific ribonuclease subunit 2; PAB-dependent poly(A)-specific ribonuclease subunit 2; ubiquitin specific protease 52; ubiquitin specific peptidase 52; AN2 polyA specific ribonuclease subunit homolog; inactive ubiquitin carboxyl-terminal hydrolase 52
• UniProt Protein Name: PAB-dependent poly(A)-specific ribonuclease subunit 2
• Protein Family: Proteasome-activating nucleotidase
• UniProt Gene Name: Pan2
• UniProt Synonym Gene Names: Kiaa0710; Usp52
• UniProt Entry Name: PAN2_MOUSE

Uniprot Description

USP52: Functions in cytoplasmic mRNA decay. As part of the Pan nuclease complex, shortens poly(A) tails of RNA when the poly(A) stretch is bound by polyadenylate-binding protein. Belongs to the peptidase C19 family. PAN2 subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Ribonuclease; Ubiquitin-specific protease; EC 3.1.13.4

Cellular Component: cytoplasm; nucleus

Molecular Function: 3'-5'-exoribonuclease activity; protein binding; nuclease activity; poly(A)-specific ribonuclease activity; nucleic acid binding; hydrolase activity; exonuclease activity

Biological Process: poly(A) tail shortening; mRNA catabolic process, exonucleolytic; mRNA processing