Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human USP4 Monoclonal Antibody | anti-USP4 antibody

USP4 (Ubiquitin-specific-processing Protease 4, Ubiquitin Carboxyl-terminal Hydrolase 4, Deubiquitinating Enzyme 4, Ubiquitin Thioesterase 4, Ubiquitous Nuclear Protein Homolog, UNP, UNPH) APC

Gene Names
USP4; UNP; Unph
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
USP4; Monoclonal Antibody; USP4 (Ubiquitin-specific-processing Protease 4; Ubiquitin Carboxyl-terminal Hydrolase 4; Deubiquitinating Enzyme 4; Ubiquitin Thioesterase 4; Ubiquitous Nuclear Protein Homolog; UNP; UNPH) APC; EC=3.4.19.12; anti-USP4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5E12
Specificity
Recognizes human USP4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-USP4 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
ELISA: 10ng/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa676-773 from human USP4 (NP_003354) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ETEGSGEDEPGNDPSETTQKKIKGQPCPKRLFTFSLVNSYGTADINSLAADGKLLKLNSRSTLAMDWDSETRRLYYDEQESEAYEKHVSMLQPQKKKK
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-USP4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35,661 Da
NCBI Official Full Name
ubiquitin carboxyl-terminal hydrolase 4 isoform a
NCBI Official Synonym Full Names
ubiquitin specific peptidase 4 (proto-oncogene)
NCBI Official Symbol
USP4
NCBI Official Synonym Symbols
UNP; Unph
NCBI Protein Information
ubiquitin carboxyl-terminal hydrolase 4; deubiquitinating enzyme 4; ubiquitin carboxyl-terminal esterase 4; ubiquitin specific protease 4 (proto-oncogene); ubiquitin thioesterase 4; ubiquitin thiolesterase 4; ubiquitin-specific processing protease 4; ubiq
UniProt Protein Name
Ubiquitin carboxyl-terminal hydrolase 4
UniProt Gene Name
USP4
UniProt Synonym Gene Names
UNP; UNPH
UniProt Entry Name
UBP4_HUMAN

Uniprot Description

USP4: Hydrolase that deubiquitinates target proteins such as the receptor ADORA2A, PDPK1 and TRIM21. Deubiquitination of ADORA2A increases the amount of functional receptor at the cell surface. Plays a role in the regulation of quality control in the ER. Interacts with RB1 (both dephosphorylated and hypophosphorylated forms). Interacts with ADORA2A (via cytoplasmic C-terminus); the interaction is direct. Interacts with RB1, RBL1 and RBL2. Overexpressed in small cell tumors and adenocarcinomas of the lung compared to wild-type lung. Expressed in the hippocampal neurons. Belongs to the peptidase C19 family. USP4 subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Ubiquitin-specific protease; Protease; EC 3.4.19.12; Oncoprotein; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 3p21.3

Cellular Component: lysosome; cytoplasm; plasma membrane; nucleus

Molecular Function: identical protein binding; protein binding; cysteine-type endopeptidase activity; metal ion binding; ubiquitin-specific protease activity; adenosine receptor binding

Biological Process: assembly of spliceosomal tri-snRNP; proteasomal ubiquitin-dependent protein catabolic process; protein deubiquitination; regulation of protein stability; negative regulation of protein ubiquitination

Similar Products

Product Notes

The USP4 usp4 (Catalog #AAA6139799) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The USP4 (Ubiquitin-specific-processing Protease 4, Ubiquitin Carboxyl-terminal Hydrolase 4, Deubiquitinating Enzyme 4, Ubiquitin Thioesterase 4, Ubiquitous Nuclear Protein Homolog, UNP, UNPH) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's USP4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). ELISA: 10ng/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the USP4 usp4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "USP4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.