Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (USF1 monoclonal antibody (M02), clone 2A7 Western Blot analysis of USF1 expression in MCF-7 (Cat # L046V1).)

Mouse USF1 Monoclonal Antibody | anti-USF1 antibody

USF1 (Upstream Transcription Factor 1, FCHL, FCHL1, HYPLIP1, MLTF, MLTFI, UEF, bHLHb11) (HRP)

Gene Names
USF1; UEF; FCHL; MLTF; FCHL1; MLTFI; HYPLIP1; bHLHb11
Applications
Western Blot
Purity
Purified
Synonyms
USF1; Monoclonal Antibody; USF1 (Upstream Transcription Factor 1; FCHL; FCHL1; HYPLIP1; MLTF; MLTFI; UEF; bHLHb11) (HRP); Upstream Transcription Factor 1; bHLHb11; anti-USF1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2A7
Specificity
Recognizes USF1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-USF1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
USF1 (NP_009053, 1aa-110aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MKGQQKTAETEEGTVQIQEGAVATGEDPTSVAIASIQSAATFPDPNVKYVFRTENGGQVMYRVIQVSEGQLDGQTEGTGAISGYPATQSMTQAVIQGAFTSDDAVDTEGT
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(USF1 monoclonal antibody (M02), clone 2A7 Western Blot analysis of USF1 expression in MCF-7 (Cat # L046V1).)

Western Blot (WB) (USF1 monoclonal antibody (M02), clone 2A7 Western Blot analysis of USF1 expression in MCF-7 (Cat # L046V1).)

Testing Data

(Detection limit for recombinant GST tagged USF1 is approximately 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged USF1 is approximately 0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-USF1 antibody
References
1. Association of thymidylate synthase enhancer region polymorphisms with thymidylate synthase activity in vivo.de Bock CE, Garg MB, Scott N, Sakoff JA, Scorgie FE, Ackland SP, Lincz LF.Pharmacogenomics J. 2010 Jun 8. 2.Use of a single chain antibody library for ovarian cancer biomarker discovery.Ramirez AB, Loch CM, Zhang Y, Liu Y, Wang X, Wayner EA, Sargent JE, Sibani S, Hainsworth E, Mendoza EA, Eugene R, Labaer J, Urban ND, McIntosh MW, Lampe PD.Mol Cell Proteomics. 2010 May 13. 3.A role of DNA-PK for the metabolic gene regulation in response to insulin. Wong RH, Chang I, Hudak CS, Hyun S, Kwan HY, Sul HS.Cell. 2009 Mar 20;136(6):1056-72.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33kDa
NCBI Official Full Name
Upstream stimulatory factor 1
NCBI Official Synonym Full Names
upstream transcription factor 1
NCBI Official Symbol
USF1
NCBI Official Synonym Symbols
UEF; FCHL; MLTF; FCHL1; MLTFI; HYPLIP1; bHLHb11
NCBI Protein Information
upstream stimulatory factor 1
UniProt Protein Name
Upstream stimulatory factor 1
UniProt Gene Name
USF1
UniProt Synonym Gene Names
BHLHB11; USF; bHLHb11
UniProt Entry Name
USF1_HUMAN

NCBI Description

This gene encodes a member of the basic helix-loop-helix leucine zipper family, and can function as a cellular transcription factor. The encoded protein can activate transcription through pyrimidine-rich initiator (Inr) elements and E-box motifs. This gene has been linked to familial combined hyperlipidemia (FCHL). Alternative splicing of this gene results in multiple transcript variants. A related pseudogene has been defined on chromosome 21. [provided by RefSeq, Feb 2013]

Uniprot Description

USF1: Transcription factor that binds to a symmetrical DNA sequence (E-boxes) (5'-CACGTG-3') that is found in a variety of viral and cellular promoters. Efficient DNA binding requires dimerization with another bHLH protein. Binds DNA as an homodimer or a heterodimer (USF1/USF2). Interacts with varicella-zoster virus IE62 protein.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 1q22-q23

Cellular Component: nucleoplasm; transcription factor complex; nucleus

Molecular Function: RNA polymerase II transcription factor activity, enhancer binding; protein binding; enzyme binding; protein homodimerization activity; sequence-specific DNA binding; protein heterodimerization activity; histone deacetylase binding; double-stranded DNA binding; bHLH transcription factor binding; protein kinase binding

Biological Process: transcription from RNA polymerase II promoter; lipid homeostasis; glucose metabolic process; late viral mRNA transcription; glucose homeostasis; regulation of transcription from RNA polymerase II promoter; negative regulation of fibrinolysis; cellular response to insulin stimulus; regulation of transcription from RNA polymerase II promoter by glucose; response to hypoxia; regulation of transcription by carbon catabolites; positive regulation of transcription from RNA polymerase II promoter by glucose; positive regulation of transcription from RNA polymerase II promoter; response to UV

Disease: Hyperlipidemia, Combined, 1

Research Articles on USF1

Similar Products

Product Notes

The USF1 usf1 (Catalog #AAA6179416) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's USF1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the USF1 usf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "USF1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.