Mouse anti-Human Uroplakin-1b Monoclonal Antibody | anti-UPK1B antibody

Uroplakin-1b (Uroplakin Ib, UPIb, UP1b, UPK1B, UPK1, Tetraspanin-20, TSPAN20, Tspan-20) (PE)

Cat. Num. AAA6160991

• Gene Names: UPK1B; UPIB; UPK1; TSPAN20
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: Uroplakin-1b; Monoclonal Antibody; Uroplakin-1b (Uroplakin Ib; UPIb; UP1b; UPK1B; UPK1; Tetraspanin-20; TSPAN20; Tspan-20) (PE); anti-UPK1B antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1E1
• Specificity: Recognizes human UPK1B.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-UPK1B antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa131-228 from human UPK1B (NP_008883) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: NNSPPNNDDQWKNNGVTKTWDRLMLQDNCCGVNGPSDWQKYTSAFRTENNDADYPWPRQCCVMNNLKEPLNLEACKLGVPGFYHNQGCYELISGPMNR
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged UPK1B is ~0.03ng/ml as a capture antibody.)

Product Categories/Family for anti-UPK1B antibody

Antibodies; Tetraspanin

NCBI and Uniprot Product Information

• NCBI GI #: 49619237
• NCBI GeneID: 7348
• NCBI Accession #: NP_008883
• NCBI GenBank Nucleotide #: NM_006952
• UniProt Accession #: O75841; O60753; Q9UIM2; Q9UNX6
• Molecular Weight: 29,643 Da
• NCBI Official Full Name: uroplakin-1b
• NCBI Official Synonym Full Names: uroplakin 1B
• NCBI Official Symbol: UPK1B
• NCBI Official Synonym Symbols: UPIB; UPK1; TSPAN20
• NCBI Protein Information: uroplakin-1b; UP1b; tspan-20; tetraspan; uroplakin Ib; tetraspanin-20
• UniProt Protein Name: Uroplakin-1b
• Protein Family: Uroplakin
• UniProt Gene Name: UPK1B
• UniProt Synonym Gene Names: TSPAN20; UP1b; Tspan-20; UPIb
• UniProt Entry Name: UPK1B_HUMAN

NCBI Description

The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is found in the asymmetrical unit membrane (AUM) where it can form a complex with other transmembrane 4 superfamily proteins. It may play a role in normal bladder epithelial physiology, possibly in regulating membrane permeability of superficial umbrella cells or in stabilizing the apical membrane through AUM/cytoskeletal interactions. The use of alternate polyadenylation sites has been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

UPK1B: Component of the asymmetric unit membrane (AUM); a highly specialized biomembrane elaborated by terminally differentiated urothelial cells. May play an important role in normal bladder epithelial physiology, possibly in regulating membrane permeability of superficial umbrella cells or in stabilizing the apical membrane through AUM/cytoskeletal interactions. Belongs to the tetraspanin (TM4SF) family.

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 3q13.32

Cellular Component: apical plasma membrane; integral to membrane

Molecular Function: structural molecule activity

Biological Process: epithelial cell differentiation