Mouse anti-Human UNC5D Monoclonal Antibody | anti-UNC5D antibody

UNC5D (Protein Unc-5 Homolog D, Netrin Receptor UNC5D, Protein Unc-5 Homolog 4, UNC5H4, KIAA1777, UNQ6012/PRO34692) (MaxLight 490)

Cat. Num. AAA6204010

• Gene Names: UNC5D; Unc5h4; PRO34692
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: UNC5D; Monoclonal Antibody; UNC5D (Protein Unc-5 Homolog D; Netrin Receptor UNC5D; Protein Unc-5 Homolog 4; UNC5H4; KIAA1777; UNQ6012/PRO34692) (MaxLight 490); anti-UNC5D antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4G3
• Specificity: Recognizes human UNC5D.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
• Sequence Length: 953

• Applicable Applications for anti-UNC5D antibody: FLISA, Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant protein corresponding to aa31-131 from human UNC5D (NP_543148) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: TDNGEALPESIPSAPGTLPHFIEEPDDAYIIKSNPIALRCKARPAMQIFFKCNGEWVHQNEHVSEETLDESSGLKVREVFINVTRQQVEDFHGPEDYWCQ
• Conjugate: MaxLight490
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Related Product Information for anti-UNC5D antibody

MaxLight490 is a new Blue-Green photostable dye conjugate comparable to DyLight488, Alexa Fluor488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000.

Product Categories/Family for anti-UNC5D antibody

Antibodies; Netrin

NCBI and Uniprot Product Information

• NCBI GI #: 209977117
• NCBI GeneID: 137970
• NCBI Accession #: NP_543148
• NCBI GenBank Nucleotide #: NM_080872
• UniProt Accession #: Q6UXZ4
• NCBI Official Full Name: netrin receptor UNC5D isoform 1
• NCBI Official Synonym Full Names: unc-5 netrin receptor D
• NCBI Official Symbol: UNC5D
• NCBI Official Synonym Symbols: Unc5h4; PRO34692
• NCBI Protein Information: netrin receptor UNC5D
• UniProt Protein Name: Netrin receptor UNC5D
• Protein Family: Netrin receptor
• UniProt Gene Name: UNC5D

Uniprot Description

Receptor for the netrin NTN4 that promotes neuronal cell survival (). Plays a role in cell-cell adhesion and cell guidance. Receptor for netrin involved in cell migration. Plays a role in axon guidance by mediating axon repulsion of neuronal growth cones in the developing nervous system upon ligand binding (). May play a role in apoptosis in response to DNA damage (PubMed:24691657). It also acts as a dependence receptor required for apoptosis induction when not associated with netrin ligand (PubMed:24519068). Mediates cell-cell adhesion via its interaction with FLRT3 on an adjacent cell ().