Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human, Mouse UNC13D Monoclonal Antibody | anti-UNC13D antibody

UNC13D (Protein Unc-13 Homolog D, Munc13-4) (AP)

Gene Names
UNC13D; FHL3; HLH3; HPLH3; Munc13-4
Reactivity
Human, Mouse
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
UNC13D; Monoclonal Antibody; UNC13D (Protein Unc-13 Homolog D; Munc13-4) (AP); anti-UNC13D antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2C7
Specificity
Recognizes human UNC13D. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-UNC13D antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa2-100 from human UNC13D (NP_954712) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ATLLSHPQQRPPFLRQAIKIRRRRVRDLQDPPPQMAPEIQPPSHHFSPEQRALLYEDALYTVLHRLGHPEPNHVTEASELLRYLQEAFHVEPEEHQQTL
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(UNC13D monoclonal antibody. Western Blot analysis of UNC13D expression in Jurkat.)

Western Blot (WB) (UNC13D monoclonal antibody. Western Blot analysis of UNC13D expression in Jurkat.)

Western Blot (WB)

(UNC13D monoclonal antibody. Western Blot analysis of UNC13D expression in NIH/3T3.)

Western Blot (WB) (UNC13D monoclonal antibody. Western Blot analysis of UNC13D expression in NIH/3T3.)

Testing Data

(Detection limit for recombinant GST tagged UNC13D is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged UNC13D is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-UNC13D antibody
This gene encodes a protein that is a member of the UNC13 family, containing similar domain structure as other family members but lacking an N-terminal phorbol ester-binding C1 domain present in other Munc13 proteins. The protein appears to play a role in vesicle maturation during exocytosis and is involved in regulation of cytolytic granules secretion. Mutations in this gene are associated with familial hemophagocytic lymphohistiocytosis type 3, a genetically heterogeneous, rare autosomal recessive disorder.
Product Categories/Family for anti-UNC13D antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
128,819 Da
NCBI Official Full Name
protein unc-13 homolog D
NCBI Official Synonym Full Names
unc-13 homolog D (C. elegans)
NCBI Official Symbol
UNC13D
NCBI Official Synonym Symbols
FHL3; HLH3; HPLH3; Munc13-4
NCBI Protein Information
protein unc-13 homolog D
UniProt Protein Name
Protein unc-13 homolog D
Protein Family
UniProt Gene Name
UNC13D
UniProt Entry Name
UN13D_HUMAN

NCBI Description

This gene encodes a protein that is a member of the UNC13 family, containing similar domain structure as other family members but lacking an N-terminal phorbol ester-binding C1 domain present in other Munc13 proteins. The protein appears to play a role in vesicle maturation during exocytosis and is involved in regulation of cytolytic granules secretion. Mutations in this gene are associated with familial hemophagocytic lymphohistiocytosis type 3, a genetically heterogeneous, rare autosomal recessive disorder. [provided by RefSeq, Jul 2008]

Uniprot Description

UNC13D: Plays a role in cytotoxic granule exocytosis in lymphocytes. Required for both granule maturation and granule docking and priming at the immunologic synapse. Regulates assembly of recycling and late endosomal structures, leading to the formation of an endosomal exocytic compartment that fuses with perforin-containing granules at the immunologic synapse and licences them for exocytosis. Regulates Ca(2+)-dependent secretory lysosome exocytosis in mast cells. Defects in UNC13D are the cause of familial hemophagocytic lymphohistiocytosis type 3 (FHL3); also known as HPLH3. Familial hemophagocytic lymphohistiocytosis (FHL) is a genetically heterogeneous, rare autosomal recessive disorder. It is characterized by immune dysregulation with hypercytokinemia and defective natural killer cell function. The clinical features of the disease include fever, hepatosplenomegaly, cytopenia, hypertriglyceridemia, hypofibrinogenemia, and neurological abnormalities ranging from irritability and hypotonia to seizures, cranial nerve deficits, and ataxia. Hemophagocytosis is a prominent feature of the disease, and a non-malignant infiltration of macrophages and activated T-lymphocytes in lymph nodes, spleen, and other organs is also found. Belongs to the unc-13 family. 3 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 17q25.1

Cellular Component: recycling endosome; membrane; lysosome; late endosome

Molecular Function: protein binding; Rab GTPase binding

Biological Process: regulation of mast cell degranulation; natural killer cell degranulation; germinal center formation; defense response to virus; granuloma formation; phagocytosis; positive regulation of exocytosis

Disease: Hemophagocytic Lymphohistiocytosis, Familial, 3

Research Articles on UNC13D

Similar Products

Product Notes

The UNC13D unc13d (Catalog #AAA6134467) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The UNC13D (Protein Unc-13 Homolog D, Munc13-4) (AP) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's UNC13D can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the UNC13D unc13d for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "UNC13D, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.