Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human ULK1 Monoclonal Antibody | anti-ULK1 antibody

ULK1 (Unc-51-like Kinase 1, Serine/threonine-protein Kinase ULK1, Autophagy-related Protein 1 Homolog, ATG1, hATG1, KIAA0722) (MaxLight 490)

Gene Names
ULK1; ATG1; ATG1A; UNC51; hATG1; Unc51.1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ULK1; Monoclonal Antibody; ULK1 (Unc-51-like Kinase 1; Serine/threonine-protein Kinase ULK1; Autophagy-related Protein 1 Homolog; ATG1; hATG1; KIAA0722) (MaxLight 490); EC=2.7.11.1; ATG1A; UNC51; Unc51.1; anti-ULK1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2H8
Specificity
Recognizes human ULK1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Applicable Applications for anti-ULK1 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa602-716 from ULK1 (NP_003556) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LRGSPKLPDFLQRNPLPPILGSPTKAVPSFDFPKTPSSQNLLALLARQGVVMTPPRNRTLPDLSEVGPFHGQPLGPGLRPGEDPKGPFGRSFSTSRLTDLLLKAAFGTQAPDPG*
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-ULK1 antibody
MaxLight490 is a new Blue-Green photostable dye conjugate comparable to DyLight488, Alexa Fluor488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000.
Product Categories/Family for anti-ULK1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
112631 MW
NCBI Official Full Name
serine/threonine-protein kinase ULK1
NCBI Official Synonym Full Names
unc-51 like autophagy activating kinase 1
NCBI Official Symbol
ULK1
NCBI Official Synonym Symbols
ATG1; ATG1A; UNC51; hATG1; Unc51.1
NCBI Protein Information
serine/threonine-protein kinase ULK1
UniProt Protein Name
Serine/threonine-protein kinase ULK1
UniProt Gene Name
ULK1
UniProt Synonym Gene Names
KIAA0722; ATG1; hATG1
UniProt Entry Name
ULK1_HUMAN

Uniprot Description

ULK1: Serine/threonine-protein kinase involved in autophagy in response to starvation. Acts upstream of phosphatidylinositol 3- kinase PIK3C3 to regulate the formation of autophagophores, the precursors of autophagosomes. Part of regulatory feedback loops in autophagy: acts both as a downstream effector and negative regulator of mammalian target of rapamycin complex 1 (mTORC1) via interaction with RPTOR. Activated via phosphorylation by AMPK and also acts as a regulator of AMPK by mediating phosphorylation of AMPK subunits PRKAA1, PRKAB2 and PRKAG1, leading to negatively regulate AMPK activity. May phosphorylate ATG13/KIAA0652 and RPTOR; however such data need additional evidences. Plays a role early in neuronal differentiation and is required for granule cell axon formation. Interacts with GABARAP and GABARAPL2. Interacts (via C- terminus) with ATG13/KIAA0652. Part of a complex consisting of ATG13/KIAA0652, ULK1 and RB1CC1. Associates with the mammalian target of rapamycin complex 1 (mTORC1) through an interaction with RPTOR; the association depends on nutrient conditions and is reduced during starvation. Ubiquitously expressed. Detected in the following adult tissues: skeletal muscle, heart, pancreas, brain, placenta, liver, kidney, and lung. Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. APG1/unc-51/ULK1 subfamily.

Protein type: Protein kinase, Other; EC 2.7.11.1; Protein kinase, Ser/Thr (non-receptor); Kinase, protein; Autophagy; Other group; ULK family

Chromosomal Location of Human Ortholog: 12q24.3

Cellular Component: neuron projection; cytoplasmic vesicle membrane; cell soma; cytoplasm; pre-autophagosomal structure membrane; autophagic vacuole; cytosol

Molecular Function: protein serine/threonine kinase activity; protein binding; protein complex binding; protein kinase binding; ATP binding; Rab GTPase binding

Biological Process: axon extension; protein amino acid autophosphorylation; neurite regeneration; negative regulation of collateral sprouting; cerebellar granule cell differentiation; protein amino acid phosphorylation; radial glia guided migration of granule cell; response to starvation; cellular response to nutrient levels; protein localization; receptor internalization; Ras protein signal transduction; regulation of autophagy; regulation of nerve growth factor receptor signaling pathway; positive regulation of macroautophagy; positive regulation of autophagy; neurite development; autophagic vacuole formation

Research Articles on ULK1

Similar Products

Product Notes

The ULK1 ulk1 (Catalog #AAA6204000) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ULK1 (Unc-51-like Kinase 1, Serine/threonine-protein Kinase ULK1, Autophagy-related Protein 1 Homolog, ATG1, hATG1, KIAA0722) (MaxLight 490) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ULK1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ULK1 ulk1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ULK1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.