Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human UHRF2 Monoclonal Antibody | anti-UHRF2 antibody

UHRF2 (Ubiquitin-like PHD and RING Finger Domain-containing Protein 2, Ubiquitin-like-containing PHD and RING Finger Domains Protein 2, E3 Ubiquitin-protein Ligase UHRF2, Np95/ICBP90-like RING Finger Protein, NIRF, Np95-like RING Finger Protein, Nuclear

Gene Names
UHRF2; NIRF; URF2; RNF107; MGC33463; DKFZp434B0920; DKFZp686G0837; RP11-472F14.2
Reactivity
Human
Applications
Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
UHRF2; Monoclonal Antibody; UHRF2 (Ubiquitin-like PHD and RING Finger Domain-containing Protein 2; Ubiquitin-like-containing PHD and RING Finger Domains Protein 2; E3 Ubiquitin-protein Ligase UHRF2; Np95/ICBP90-like RING Finger Protein; NIRF; Np95-like RING Finger Protein; Nuclear; EC=6.3.2.-; URF2; RP11-472F14.2; anti-UHRF2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3A11
Specificity
Recognizes human UHRF2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-UHRF2 antibody
FLISA, Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa81-181 from human UHRF2 (NP_690856) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PGTSTQIEAKPCSNSPPKVKKAPRVGPSNQPSTSARARLIDPGFGIYKVNELVDARDVGLGAWFEAHIHSVTRASDGQSRGKTPLKNGSSCKRTNGNIKH
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-UHRF2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
89,985 Da
NCBI Official Full Name
E3 ubiquitin-protein ligase UHRF2
NCBI Official Synonym Full Names
ubiquitin-like with PHD and ring finger domains 2
NCBI Official Symbol
UHRF2
NCBI Official Synonym Symbols
NIRF; URF2; RNF107; MGC33463; DKFZp434B0920; DKFZp686G0837; RP11-472F14.2
NCBI Protein Information
E3 ubiquitin-protein ligase UHRF2; OTTHUMP00000021047; nuclear protein 97; RING finger protein 107; Np95-like ring finger protein; nuclear zinc finger protein NP97; np95/ICBP90-like RING finger protein; ubiquitin-like, containing PHD and RING finger domai
UniProt Protein Name
E3 ubiquitin-protein ligase UHRF2
UniProt Gene Name
UHRF2
UniProt Synonym Gene Names
NIRF; RNF107; Np95-like RING finger protein
UniProt Entry Name
UHRF2_HUMAN

Uniprot Description

UHRF2: E3 ubiquitin-protein ligase that is an intermolecular hub protein in the cell cycle network. Through cooperative DNA and histone binding, may contribute to a tighter epigenetic control of gene expression in differentiated cells. Ubiquitinates cyclins, CCND1 and CCNE1, in an apparently phosphorylation-independent manner and induces G1 arrest. Also ubiquitinates PCNP leading to its degradation by the proteasome. Appears to contribute to tumorigenesis. Associated with various cancers. DNA copy number loss is found in multiple kinds of malignancies originating from the brain, breast, stomach, kidney, hematopoietic tissue and lung. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 6.3.2.-; Ubiquitin conjugating system; EC 6.3.2.19; Ubiquitin ligase; Cell cycle regulation; Ligase

Chromosomal Location of Human Ortholog: 9p24.1

Cellular Component: nucleoplasm; nuclear heterochromatin; nucleus

Molecular Function: protein binding; DNA binding; zinc ion binding; histone binding; ubiquitin-protein ligase activity; ligase activity

Biological Process: ubiquitin-dependent protein catabolic process; cell proliferation; protein autoubiquitination; regulation of cell cycle; protein ubiquitination; cell differentiation; cell cycle

Similar Products

Product Notes

The UHRF2 uhrf2 (Catalog #AAA6236024) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The UHRF2 (Ubiquitin-like PHD and RING Finger Domain-containing Protein 2, Ubiquitin-like-containing PHD and RING Finger Domains Protein 2, E3 Ubiquitin-protein Ligase UHRF2, Np95/ICBP90-like RING Finger Protein, NIRF, Np95-like RING Finger Protein, Nuclear reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's UHRF2 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the UHRF2 uhrf2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "UHRF2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.