Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human UBR2 Monoclonal Antibody | anti-UBR2 antibody

UBR2 (E3 Ubiquitin-protein Ligase UBR2, C6orf133, KIAA0349, N-recognin-2, Ubiquitin-protein Ligase E3-alpha-2, Ubiquitin-protein Ligase E3-alpha-II) (Biotin)

Gene Names
UBR2; C6orf133; bA49A4.1; dJ242G1.1; dJ392M17.3
Reactivity
Human
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
UBR2; Monoclonal Antibody; UBR2 (E3 Ubiquitin-protein Ligase UBR2; C6orf133; KIAA0349; N-recognin-2; Ubiquitin-protein Ligase E3-alpha-2; Ubiquitin-protein Ligase E3-alpha-II) (Biotin); EC=6.3.2.-; bA49A4.1; dJ242G1.1; dJ392M17.3; RP3-392M17.3; anti-UBR2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4G4
Specificity
Recognizes human UBR2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
7898
Applicable Applications for anti-UBR2 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-101 from UBR2 (NP_056070) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MASELEPEVQAIDRSLLECSAEEIAGKWLQATDLTREVYQHLAHYVPKIYCRGPNPFPQKEDMLAQHVLLGPMEWYLCGEDPAFGFPKLEQANKPSHLCG*
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(Western Blot analysis of UBR2 expression in transfected 293T cell line by UBR2 monoclonal antibody Lane 1: UBR2 transfected lysate (5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of UBR2 expression in transfected 293T cell line by UBR2 monoclonal antibody Lane 1: UBR2 transfected lysate (5kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to UBR2 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to UBR2 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged UBR2 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged UBR2 is ~0.3ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of UBR2 over-expressed 293 cell line, cotransfected with UBR2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with UBR2 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of UBR2 over-expressed 293 cell line, cotransfected with UBR2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with UBR2 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)
Product Categories/Family for anti-UBR2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens ubiquitin protein ligase E3 component n-recognin 2 (UBR2), transcript variant 1, mRNA
NCBI Official Synonym Full Names
ubiquitin protein ligase E3 component n-recognin 2
NCBI Official Symbol
UBR2
NCBI Official Synonym Symbols
C6orf133; bA49A4.1; dJ242G1.1; dJ392M17.3
NCBI Protein Information
E3 ubiquitin-protein ligase UBR2
UniProt Protein Name
E3 ubiquitin-protein ligase UBR2
UniProt Gene Name
UBR2
UniProt Synonym Gene Names
C6orf133; KIAA0349
UniProt Entry Name
UBR2_HUMAN

NCBI Description

This gene encodes an E3 ubiquitin ligase of the N-end rule proteolytic pathway that targets proteins with destabilizing N-terminal residues for polyubiquitylation and proteasome-mediated degradation. Alternative splicing results in multiple transcript variants.[provided by RefSeq, May 2010]

Uniprot Description

UBR2: E3 ubiquitin-protein ligase which is a component of the N-end rule pathway. Recognizes and binds to proteins bearing specific N-terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation. Plays a critical role in chromatin inactivation and chromosome-wide transcriptional silencing during meiosis via ubiquitination of histone H2A. Binds leucine and is a negative regulator of the leucine-mTOR signaling pathway, thereby controlling cell growth. Belongs to the UBR1 family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Ligase; EC 6.3.2.-; EC 6.3.2.19; Ubiquitin ligase; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 6p21.1

Cellular Component: nucleoplasm; plasma membrane; chromatin; ubiquitin ligase complex

Molecular Function: protein binding; zinc ion binding; ubiquitin-protein ligase activity; ligase activity

Biological Process: ubiquitin-dependent protein catabolic process; negative regulation of TOR signaling pathway; male meiosis I; chromatin silencing; spermatogenesis; histone H2A ubiquitination

Research Articles on UBR2

Similar Products

Product Notes

The UBR2 ubr2 (Catalog #AAA6145049) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The UBR2 (E3 Ubiquitin-protein Ligase UBR2, C6orf133, KIAA0349, N-recognin-2, Ubiquitin-protein Ligase E3-alpha-2, Ubiquitin-protein Ligase E3-alpha-II) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's UBR2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the UBR2 ubr2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "UBR2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.