Mouse UBE2Z Monoclonal Antibody | anti-UBE2Z antibody

UBE2Z (Ubiquitin-conjugating Enzyme E2Z, FLJ13855, HOYS7, USE1) (Biotin)

Cat. Num. AAA6174266

• Gene Names: UBE2Z; USE1; HOYS7
• Applications: Immunofluorescence, Western Blot
• Purity: Purified
• Synonyms: UBE2Z; Monoclonal Antibody; UBE2Z (Ubiquitin-conjugating Enzyme E2Z; FLJ13855; HOYS7; USE1) (Biotin); Ubiquitin-conjugating Enzyme E2Z; USE1; anti-UBE2Z antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4B1
• Specificity: Recognizes UBE2Z.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-UBE2Z antibody: Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: UBE2Z (NP_075567, 136aa-225aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: IRHETIRVAVCDMMEGKCPCPEPLRGVMEKSFLEYYDFYEVACKDRLHLQGQTMQDPFGEKRGHFDYQSLLMRLGLIRQKVLERLHNENA
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(UBE2Z monoclonal antibody (M01), clone 4B1. Western Blot analysis of UBE2Z expression in K-562.)

Testing Data

(Detection limit for recombinant GST tagged UBE2Z is 3 ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to UBE2Z on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to UBE2Z on HeLa cell. [antibody concentration 10 ug/ml])

Related Product Information for anti-UBE2Z antibody

Modification of proteins with ubiquitin (UBB; MIM 191339) or ubiquitin-like proteins controls many signaling networks and requires a ubiquitin activating enzyme (E1), a ubiquitin conjugating enzyme (E2), and a ubiquitin protein ligase (E3). UBE2Z is an E2 enzyme (Jin et al., 2007 [PubMed 17597759]). [supplied by OMIM]

Product Categories/Family for anti-UBE2Z antibody

Antibodies; Ubiquitin Ligases

NCBI and Uniprot Product Information

• NCBI GI #: 150417999
• NCBI GeneID: 65264
• NCBI Accession #: NP_075567
• NCBI GenBank Nucleotide #: NM_023079
• UniProt Accession #: Q9H832
• Molecular Weight: 27kDa
• NCBI Official Full Name: ubiquitin-conjugating enzyme E2 Z
• NCBI Official Synonym Full Names: ubiquitin conjugating enzyme E2 Z
• NCBI Official Symbol: UBE2Z
• NCBI Official Synonym Symbols: USE1; HOYS7
• NCBI Protein Information: ubiquitin-conjugating enzyme E2 Z
• UniProt Protein Name: Ubiquitin-conjugating enzyme E2 Z
• Protein Family: Ubiquitin-conjugating enzyme
• UniProt Gene Name: UBE2Z
• UniProt Synonym Gene Names: Use1
• UniProt Entry Name: UBE2Z_HUMAN

NCBI Description

This gene encodes an enzyme which ubiquitinates proteins which participate in signaling pathways and apoptosis. [provided by RefSeq, Feb 2012]

Uniprot Description

Function: Catalyzes the covalent attachment of ubiquitin to other proteins

By similarity. Specific substrate for UBA6, not charged with ubiquitin by UBE1. May be involved in apoptosis regulation. Ref.1 Ref.10

Catalytic activity: ATP + ubiquitin + protein lysine = AMP + diphosphate + protein N-ubiquityllysine.

Pathway: Protein modification; protein ubiquitination.

Subcellular location: Cytoplasm. Nucleus Ref.9.

Tissue specificity: Widely expressed. Highly in placenta, pancreas, spleen and testis. Ref.1 Ref.9

Sequence similarities: Belongs to the ubiquitin-conjugating enzyme family.

Sequence caution: The sequence AAH15890.1 differs from that shown. Reason: Erroneous initiation. The sequence BAB14724.1 differs from that shown. Reason: Erroneous initiation.