Western Blot (WB)
(Western Blot analysis of UBE2T expression in transfected 293T cell line by UBE2T monoclonal antibody (M03), clone 2A12-4F11.Lane 1: UBE2T transfected lysate (22.5 KDa).Lane 2: Non-transfected lysate.)
Mouse UBE2T Monoclonal Antibody | anti-UBE2T antibody
UBE2T (Ubiquitin-conjugating Enzyme E2T (Putative), HSPC150, PIG50) (PE)
Gene Names
UBE2T; FANCT; PIG50; HSPC150
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified
Synonyms
UBE2T; Monoclonal Antibody; UBE2T (Ubiquitin-conjugating Enzyme E2T (Putative); HSPC150; PIG50) (PE); Ubiquitin-conjugating Enzyme E2T (Putative); PIG50; anti-UBE2T antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2A12-4F11
Specificity
Recognizes UBE2T.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
197
Applicable Applications for anti-UBE2T antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
UBE2T (AAH04152, 1aa-197aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFLKNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVHNSTQKRKASQLVGIEKKFHPDV
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of UBE2T expression in transfected 293T cell line by UBE2T monoclonal antibody (M03), clone 2A12-4F11.Lane 1: UBE2T transfected lysate (22.5 KDa).Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of UBE2T expression in transfected 293T cell line by UBE2T monoclonal antibody (M03), clone 2A12-4F11.Lane 1: UBE2T transfected lysate (22.5 KDa).Lane 2: Non-transfected lysate.)
Immunoprecipitation (IP)
(Immunoprecipitation of UBE2T transfected lysate using anti-UBE2T monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with UBE2T MaxPab rabbit polyclonal antibody.)
Immunoprecipitation (IP)
(Immunoprecipitation of UBE2T transfected lysate using anti-UBE2T monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with UBE2T MaxPab rabbit polyclonal antibody.)
Related Product Information for anti-UBE2T antibody
The covalent conjugation of ubiquitin to proteins regulates diverse cellular pathways and proteins. Ubiquitin is transferred to a target protein through a concerted action of a ubiquitin-activating enzyme (E1), a ubiquitin-conjugating enzyme (E2), such as UBE2T, and a ubiquitin ligase (E3) (Machida et al., 2006 [PubMed 16916645]). [supplied by OMIM]
Product Categories/Family for anti-UBE2T antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
Ubiquitin-conjugating enzyme E2T (putative)
NCBI Official Synonym Full Names
ubiquitin conjugating enzyme E2 T
NCBI Official Symbol
UBE2T
NCBI Official Synonym Symbols
FANCT; PIG50; HSPC150
NCBI Protein Information
ubiquitin-conjugating enzyme E2 T
Protein Family
NCBI Description
The protein encoded by this gene catalyzes the covalent attachment of ubiquitin to protein substrates. Defects in this gene have been associated with Fanconi anemia of complementation group T. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2015]
Research Articles on UBE2T
Similar Products
Product Notes
The UBE2T (Catalog #AAA6186711) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's UBE2T can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the UBE2T for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "UBE2T, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
