Western Blot (WB)
(Western Blot detection against Immunogen (52.29kD).)
Mouse anti-Human UBE2R2 Monoclonal Antibody | anti-UBE2R2 antibody
UBE2R2 (Ubiquitin-conjugating Enzyme E2 R2, CDC34B, UBC3B, Ubiquitin Carrier Protein R2, Ubiquitin-conjugating Enzyme E2-CDC34B, Ubiquitin-protein Ligase R2) (PE)
Gene Names
UBE2R2; UBC3B; CDC34B; E2-CDC34B
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
UBE2R2; Monoclonal Antibody; UBE2R2 (Ubiquitin-conjugating Enzyme E2 R2; CDC34B; UBC3B; Ubiquitin Carrier Protein R2; Ubiquitin-conjugating Enzyme E2-CDC34B; Ubiquitin-protein Ligase R2) (PE); EC=6.3.2.19; anti-UBE2R2 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
5E7
Specificity
Recognizes human UBE2R2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
1913
Applicable Applications for anti-UBE2R2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
ELISA: 0.1ng/ml
Applications are based on unconjugated antibody.
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-239 from human UBE2R2 (AAH47584) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAQQQMTSSQKALMLELKSLQEEPVEGFRITLVDESDLYNWEVAIFGPPNTLYEGGYFKAHIKFPIDYPYSPPTFRFLTKMWHPNIYENGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMFRKWRDSKGKDKEYAEIIRKQVSATKAEAEKDGVKVPTTLAEYCIKTKVPSNDNSSDLLYDDLYDDDIDDEDEEEEDADCYDDDDSGNEES
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (52.29kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (52.29kD).)
Western Blot (WB)
(UBE2R2 monoclonal antibody, Western Blot analysis of UBE2R2 expression in Jurkat.)
Western Blot (WB)
(UBE2R2 monoclonal antibody, Western Blot analysis of UBE2R2 expression in Jurkat.)
Testing Data
(Detection limit for recombinant GST tagged UBE2R2 is ~0.1ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged UBE2R2 is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-UBE2R2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens ubiquitin-conjugating enzyme E2R 2, mRNA
NCBI Official Synonym Full Names
ubiquitin conjugating enzyme E2 R2
NCBI Official Symbol
UBE2R2
NCBI Official Synonym Symbols
UBC3B; CDC34B; E2-CDC34B
NCBI Protein Information
ubiquitin-conjugating enzyme E2 R2
Protein Family
NCBI Description
Protein kinase CK2 is a ubiquitous and pleiotropic Ser/Thr protein kinase involved in cell growth and transformation. This gene encodes a protein similar to the E2 ubiquitin conjugating enzyme UBC3/CDC34. Studies suggest that CK2-dependent phosphorylation of this ubiquitin-conjugating enzyme functions by regulating beta-TrCP substrate recognition and induces its interaction with beta-TrCP, enhancing beta-catenin degradation. [provided by RefSeq, Jul 2008]
Research Articles on UBE2R2
Similar Products
Product Notes
The UBE2R2 (Catalog #AAA6160943) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The UBE2R2 (Ubiquitin-conjugating Enzyme E2 R2, CDC34B, UBC3B, Ubiquitin Carrier Protein R2, Ubiquitin-conjugating Enzyme E2-CDC34B, Ubiquitin-protein Ligase R2) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's UBE2R2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). ELISA: 0.1ng/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the UBE2R2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "UBE2R2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
