Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (42.57kD).)

Mouse anti-Human UBE2L6 Monoclonal Antibody | anti-UBE2L6 antibody

UBE2L6 (Ubiquitin/ISG15-conjugating Enzyme E2 L6, Retinoic Acid-induced Gene B Protein, RIG-B, UbcH8, Ubiquitin Carrier Protein L6, Ubiquitin-protein Ligase L6) (HRP)

Gene Names
UBE2L6; RIG-B; UBCH8
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
UBE2L6; Monoclonal Antibody; UBE2L6 (Ubiquitin/ISG15-conjugating Enzyme E2 L6; Retinoic Acid-induced Gene B Protein; RIG-B; UbcH8; Ubiquitin Carrier Protein L6; Ubiquitin-protein Ligase L6) (HRP); EC=6.3.2.19; anti-UBE2L6 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2F12-1F4
Specificity
Recognizes human UBE2L6.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-UBE2L6 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-153 from UBE2L6 (AAH32491) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRPS
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (42.57kD).)

Western Blot (WB) (Western Blot detection against Immunogen (42.57kD).)

Western Blot (WB)

(Western Blot analysis of UBE2L6 expression in transfected 293T cell line by UBE2L6 monoclonal antibody. Lane 1: UBE2L6 transfected lysate (17.595kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of UBE2L6 expression in transfected 293T cell line by UBE2L6 monoclonal antibody. Lane 1: UBE2L6 transfected lysate (17.595kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged UBE2L6 is 3ng/ml as a capture antibody)

Testing Data (Detection limit for recombinant GST tagged UBE2L6 is 3ng/ml as a capture antibody)
Product Categories/Family for anti-UBE2L6 antibody
References
1. Interactions between PBEF and oxidative stress proteins - A potential new mechanism underlying PBEF in the pathogenesis of acute lung injury. Zhang LQ, Adyshev DM, Singleton P, Li H, Cepeda J, Huang SY, Zou X, Verin AD, Tu J, Garcia JG, Ye SQ.FEBS Lett. 2008 Jun 11;582(13):1802-8. Epub 2008 May 16.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
10,086 Da
NCBI Official Full Name
Homo sapiens ubiquitin-conjugating enzyme E2L 6, mRNA
NCBI Official Synonym Full Names
ubiquitin conjugating enzyme E2 L6
NCBI Official Symbol
UBE2L6
NCBI Official Synonym Symbols
RIG-B; UBCH8
NCBI Protein Information
ubiquitin/ISG15-conjugating enzyme E2 L6

NCBI Description

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s) and ubiquitin-protein ligases (E3s). This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is highly similar in primary structure to the enzyme encoded by the UBE2L3 gene. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, May 2011]

Research Articles on UBE2L6

Similar Products

Product Notes

The UBE2L6 (Catalog #AAA6155635) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The UBE2L6 (Ubiquitin/ISG15-conjugating Enzyme E2 L6, Retinoic Acid-induced Gene B Protein, RIG-B, UbcH8, Ubiquitin Carrier Protein L6, Ubiquitin-protein Ligase L6) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's UBE2L6 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the UBE2L6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "UBE2L6, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.