Mouse anti-Human UBE2E2 Monoclonal Antibody | anti-UBE2E2 antibody

UBE2E2 (Ubiquitin-conjugating Enzyme E2 E2, UbcH8, Ubiquitin Carrier Protein E2, Ubiquitin-protein Ligase E2)

Cat. Num. AAA6011131

• Gene Names: UBE2E2; UBCH8
• Reactivity: Human
• Applications: ELISA, Western Blot, Immunofluorescence
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: UBE2E2; Monoclonal Antibody; UBE2E2 (Ubiquitin-conjugating Enzyme E2 E2; UbcH8; Ubiquitin Carrier Protein E2; Ubiquitin-protein Ligase E2); Anti -UBE2E2 (Ubiquitin-conjugating Enzyme E2 E2; anti-UBE2E2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 4B4
• Specificity: Recognizes human UBE2E2.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MSTEAQRVDDSPSTSGGSSDGDQRESVQQEPEREQVQPKKKEGKISSKTAAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSPDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYAT

• Applicable Applications for anti-UBE2E2 antibody: ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF)
• Application Notes: Suitable for use in Immunofluorescence, ELISA and Western Blot.; Dilution: Immunofluorescence: 10ug/ml
• Immunogen: Full length recombinant corresponding to aa1-201 from human UBE2E2 (AAH22332) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to UBE2E2 on HeLa cell . [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged UBE2E2 is ~0.03ng/ml as a capture antibody.)

Product Categories/Family for anti-UBE2E2 antibody

Antibodies; Abs to Ubiquitin

NCBI and Uniprot Product Information

• NCBI GI #: 22749327
• NCBI GeneID: 7325
• NCBI Accession #: NP_689866.1
• NCBI GenBank Nucleotide #: NM_152653.3
• UniProt Accession #: Q96LR5
• Molecular Weight: 22,255 Da
• NCBI Official Full Name: ubiquitin-conjugating enzyme E2 E2
• NCBI Official Synonym Full Names: ubiquitin-conjugating enzyme E2E 2
• NCBI Official Symbol: UBE2E2
• NCBI Official Synonym Symbols: UBCH8
• NCBI Protein Information: ubiquitin-conjugating enzyme E2 E2; ubiquitin-protein ligase E2; ubiquitin carrier protein E2; ubiquitin-conjugating enzyme E2E 2 (UBC4/5 homolog, yeast); ubiquitin-conjugating enzyme E2E 2 (homologous to yeast UBC4/5)
• UniProt Protein Name: Ubiquitin-conjugating enzyme E2 E2
• Protein Family: Ubiquitin-conjugating enzyme
• UniProt Gene Name: UBE2E2
• UniProt Synonym Gene Names: UBCH8
• UniProt Entry Name: UB2E2_HUMAN

Uniprot Description

UBE2E2: Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys- 11'- and 'Lys-48'-, as well as 'Lys-63'-linked polyubiquitination. Belongs to the ubiquitin-conjugating enzyme family.

Protein type: Ubiquitin ligase; Ligase; EC 6.3.2.19; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 3p24.2

Molecular Function: ISG15 conjugating enzyme activity; protein binding; ubiquitin-protein ligase activity; ATP binding; ligase activity

Biological Process: ISG15-protein conjugation; response to DNA damage stimulus