Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of UBE2B expression in transfected 293T cell line by UBE2B monoclonal antibody. Lane 1: UBE2B transfected lysate (17.3kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human UBE2B Monoclonal Antibody | anti-UBE2B antibody

UBE2B (Ubiquitin-conjugating Enzyme E2 B, Ubiquitin-protein Ligase B, Ubiquitin Carrier Protein B, RAD6 Homolog B, HR6B, Ubiquitin-conjugating Enzyme E2-17kD, RAD6B) (PE)

Gene Names
UBE2B; HR6B; UBC2; HHR6B; RAD6B; E2-17kDa
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
UBE2B; Monoclonal Antibody; UBE2B (Ubiquitin-conjugating Enzyme E2 B; Ubiquitin-protein Ligase B; Ubiquitin Carrier Protein B; RAD6 Homolog B; HR6B; Ubiquitin-conjugating Enzyme E2-17kD; RAD6B) (PE); anti-UBE2B antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4C3
Specificity
Recognizes human UBE2B.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-UBE2B antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa63-152 from human UBE2B (NP_003328) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
YPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEKRVSAIVEQSWNDS
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of UBE2B expression in transfected 293T cell line by UBE2B monoclonal antibody. Lane 1: UBE2B transfected lysate (17.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of UBE2B expression in transfected 293T cell line by UBE2B monoclonal antibody. Lane 1: UBE2B transfected lysate (17.3kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged UBE2B is ~3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged UBE2B is ~3ng/ml as a capture antibody.)
Product Categories/Family for anti-UBE2B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17,312 Da
NCBI Official Full Name
ubiquitin-conjugating enzyme E2 B
NCBI Official Synonym Full Names
ubiquitin-conjugating enzyme E2B
NCBI Official Symbol
UBE2B
NCBI Official Synonym Symbols
HR6B; UBC2; HHR6B; RAD6B; E2-17kDa
NCBI Protein Information
ubiquitin-conjugating enzyme E2 B; E2 protein; RAD6 homolog B; ubiquitin carrier protein B; ubiquitin-conjugating enzyme E2-17 kDa; ubiquitin-conjugating enzyme E2B (RAD6 homolog); ubiquitin-protein ligase B
UniProt Protein Name
Ubiquitin-conjugating enzyme E2 B
UniProt Gene Name
UBE2B
UniProt Synonym Gene Names
RAD6B; HR6B; hHR6B
UniProt Entry Name
UBE2B_HUMAN

NCBI Description

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is required for post-replicative DNA damage repair. Its protein sequence is 100% identical to the mouse, rat, and rabbit homologs, which indicates that this enzyme is highly conserved in eukaryotic evolution. [provided by RefSeq, Jul 2008]

Uniprot Description

UBE2B: a ubiquitin-protein ligase, a member of the ubiquitin-conjugating enzyme family. Homologous to the yeast DNA repair gene RAD6. Interacts with RAD18. Required for postreplication repair of UV-damaged DNA.

Protein type: Ligase; EC 6.3.2.19; Ubiquitin conjugating system; Ubiquitin ligase

Chromosomal Location of Human Ortholog: 5q31.1

Cellular Component: XY body; nuclear chromatin; cytoplasm; plasma membrane; replication fork; chromatin; nucleus

Molecular Function: protein binding; small conjugating protein ligase activity; ubiquitin protein ligase binding; ubiquitin-protein ligase activity; ATP binding; ligase activity

Biological Process: response to drug; protein monoubiquitination; ubiquitin-dependent protein catabolic process; proteasomal ubiquitin-dependent protein catabolic process; protein autoubiquitination; protein polyubiquitination; protein stabilization; in utero embryonic development; postreplication repair; protein ubiquitination; Wnt receptor signaling pathway through beta-catenin; DNA repair; negative regulation of histone phosphorylation; cellular response to insulin stimulus; maintenance of chromatin silencing; response to hypoxia; sperm axoneme assembly; spermatogenesis; chiasma formation; response to DNA damage stimulus; histone H2A ubiquitination; response to UV; negative regulation of apoptosis

Research Articles on UBE2B

Similar Products

Product Notes

The UBE2B ube2b (Catalog #AAA6160925) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The UBE2B (Ubiquitin-conjugating Enzyme E2 B, Ubiquitin-protein Ligase B, Ubiquitin Carrier Protein B, RAD6 Homolog B, HR6B, Ubiquitin-conjugating Enzyme E2-17kD, RAD6B) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's UBE2B can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the UBE2B ube2b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "UBE2B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.