Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (35.79kD).)

Mouse anti-Human UBCH9 Monoclonal Antibody | anti-UBCH9 antibody

UBCH9 (Ubiquitin-conjugating Enzyme E2 E3, Ubiquitin-protein Ligase E3, Ubiquitin Carrier Protein E3, Ubiquitin-conjugating Enzyme E2-23kD, UbcH9, UBE2E3, UBCE4) (FITC)

Gene Names
UBE2E3; UBCH9; UbcM2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
UBCH9; Monoclonal Antibody; UBCH9 (Ubiquitin-conjugating Enzyme E2 E3; Ubiquitin-protein Ligase E3; Ubiquitin Carrier Protein E3; Ubiquitin-conjugating Enzyme E2-23kD; UbcH9; UBE2E3; UBCE4) (FITC); anti-UBCH9 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3E9
Specificity
Recognizes human UBE2E3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-UBCH9 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa65-152 from UBE2E3 (NP_006348) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDN
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.79kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.79kD).)

Testing Data

(Detection limit for recombinant GST tagged UBE2E3 is ~3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged UBE2E3 is ~3ng/ml as a capture antibody.)
Product Categories/Family for anti-UBCH9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25.3kDa (230aa), confirmed by MALDI-TOF
NCBI Official Full Name
ubiquitin-conjugating enzyme E2 E3
NCBI Official Synonym Full Names
ubiquitin conjugating enzyme E2 E3
NCBI Official Symbol
UBE2E3
NCBI Official Synonym Symbols
UBCH9; UbcM2
NCBI Protein Information
ubiquitin-conjugating enzyme E2 E3
UniProt Protein Name
Ubiquitin-conjugating enzyme E2 E3
UniProt Gene Name
UBE2E3
UniProt Synonym Gene Names
UBCE4; UBCH9
UniProt Entry Name
UB2E3_HUMAN

NCBI Description

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein shares 100% sequence identity with the mouse and rat counterparts, which indicates that this enzyme is highly conserved in eukaryotes. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jun 2013]

Uniprot Description

UBE2E3: Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys- 11'- and 'Lys-48'-, as well as 'Lys-63'-linked polyubiquitination. Participates in the regulation of transepithelial sodium transport in renal cells. May be involved in cell growth arrest. Belongs to the ubiquitin-conjugating enzyme family.

Protein type: EC 6.3.2.19; Ligase; Ubiquitin conjugating system; Ubiquitin ligase

Chromosomal Location of Human Ortholog: 2q32.1

Molecular Function: protein binding; ubiquitin-protein ligase activity

Research Articles on UBCH9

Similar Products

Product Notes

The UBCH9 ube2e3 (Catalog #AAA6150317) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The UBCH9 (Ubiquitin-conjugating Enzyme E2 E3, Ubiquitin-protein Ligase E3, Ubiquitin Carrier Protein E3, Ubiquitin-conjugating Enzyme E2-23kD, UbcH9, UBE2E3, UBCE4) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's UBCH9 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the UBCH9 ube2e3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "UBCH9, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.