Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.89kD).)

Mouse anti-Human UBASH3B Monoclonal Antibody | anti-UBASH3B antibody

UBASH3B (Ubiquitin-associated and SH3 Domain-containing Protein B, Cbl-interacting Protein p70, KIAA1959, Suppressor of T-cell Receptor Signaling 1, STS1, STS-1, T-cell Ubiquitin Ligand 2, TULA-2, Tyrosine-protein Phosphatase STS1/TULA2) (PE)

Gene Names
UBASH3B; p70; STS1; STS-1; TULA-2; KIAA1959; MGC15437
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
UBASH3B; Monoclonal Antibody; UBASH3B (Ubiquitin-associated and SH3 Domain-containing Protein B; Cbl-interacting Protein p70; KIAA1959; Suppressor of T-cell Receptor Signaling 1; STS1; STS-1; T-cell Ubiquitin Ligand 2; TULA-2; Tyrosine-protein Phosphatase STS1/TULA2) (PE); EC=3.1.3.48; anti-UBASH3B antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3G7
Specificity
Recognizes human STS-1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-UBASH3B antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa344-442 from human STS-1 (NP_116262) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DGVLERRPYEDQGLGETTPLTIICQPMQPLRVNSQPGPQKRCLFVCRHGERMDVVFGKYWLSQCFDAKGRYIRTNLNMPHSLPQRSGGFRDYEKDAPI
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.89kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.89kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to UBASH3B on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to UBASH3B on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml].)
Product Categories/Family for anti-UBASH3B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
72,696 Da
NCBI Official Full Name
ubiquitin-associated and SH3 domain-containing protein B
NCBI Official Synonym Full Names
ubiquitin associated and SH3 domain containing B
NCBI Official Symbol
UBASH3B
NCBI Official Synonym Symbols
p70; STS1; STS-1; TULA-2; KIAA1959; MGC15437
NCBI Protein Information
ubiquitin-associated and SH3 domain-containing protein B; OTTHUMP00000231738; T-cell ubiquitin ligand 2; cbl-interacting protein p70; Cbl-interacting protein Sts-1; nm23-phosphorylated unknown substrate; tyrosine-protein phosphatase STS1/TULA2; suppressor
UniProt Protein Name
Ubiquitin-associated and SH3 domain-containing protein B
UniProt Gene Name
UBASH3B
UniProt Synonym Gene Names
KIAA1959; STS1; STS-1; TULA-2
UniProt Entry Name
UBS3B_HUMAN

Uniprot Description

STS-1: Interferes with CBL-mediated down-regulation and degradation of receptor-type tyrosine kinases. Promotes accumulation of activated target receptors, such as T-cell receptors and EGFR, on the cell surface. Exhibits tyrosine phosphatase activity toward several substrates including EGFR, FAK, SYK, and ZAP70. Down-regulates proteins that are dually modified by both protein tyrosine phosphorylation and ubiquitination.

Protein type: EC 3.1.3.48; Protein phosphatase, tyrosine (non-receptor)

Chromosomal Location of Human Ortholog: 11q24.1

Cellular Component: cytoplasm; nucleus

Molecular Function: protein binding; protein tyrosine phosphatase activity

Biological Process: negative regulation of protein kinase activity; regulation of release of sequestered calcium ion into cytosol

Similar Products

Product Notes

The UBASH3B ubash3b (Catalog #AAA6160562) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The UBASH3B (Ubiquitin-associated and SH3 Domain-containing Protein B, Cbl-interacting Protein p70, KIAA1959, Suppressor of T-cell Receptor Signaling 1, STS1, STS-1, T-cell Ubiquitin Ligand 2, TULA-2, Tyrosine-protein Phosphatase STS1/TULA2) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's UBASH3B can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the UBASH3B ubash3b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "UBASH3B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.