Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human UBASH3A Monoclonal Antibody | anti-UBASH3A antibody

UBASH3A (Ubiquitin-associated and SH3 Domain-containing Protein A, Cbl-interacting Protein 4, CLIP4, Suppressor of T-cell Receptor Signaling 2, STS2, STS-2, T-cell Ubiquitin Ligand 1, TULA-1, TULA) (FITC)

Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
UBASH3A; Monoclonal Antibody; UBASH3A (Ubiquitin-associated and SH3 Domain-containing Protein A; Cbl-interacting Protein 4; CLIP4; Suppressor of T-cell Receptor Signaling 2; STS2; STS-2; T-cell Ubiquitin Ligand 1; TULA-1; TULA) (FITC); anti-UBASH3A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4D2
Specificity
Recognizes human UBASH3A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
623
Applicable Applications for anti-UBASH3A antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa524-624 from human UBASH3A (NP_001001895) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MDRCTASMVQIVNTCPQDTGVILIVSHGSTLDSCTRPLLGLPPRECGDFAQLVRKIPSLGMCFCEENKEEGKWELVNPPVKTLTHGANAAFNWRNWISGN
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Immunoprecipitation (IP)

(Immunoprecipitation of UBASH3A transfected lysate using UBASH3A monoclonal antibody and Protein A Magnetic Bead and immunoblotted with UBASH3A rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of UBASH3A transfected lysate using UBASH3A monoclonal antibody and Protein A Magnetic Bead and immunoblotted with UBASH3A rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged UBASH3A is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged UBASH3A is 0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-UBASH3A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
ubiquitin-associated and SH3 domain-containing protein A isoform 2
UniProt Protein Name
Ubiquitin-associated and SH3 domain-containing protein A
UniProt Gene Name
UBASH3A
UniProt Synonym Gene Names
STS2; CLIP4; STS-2; TULA-1
UniProt Entry Name
UBS3A_HUMAN

Uniprot Description

STS2: Interferes with CBL-mediated down-regulation and degradation of receptor-type tyrosine kinases. Promotes accumulation of activated target receptors, such as T-cell receptors, EGFR and PDGFRB, on the cell surface. Exhibits negligigle protein tyrosine phosphatase activity at neutral pH. May act as a dominant-negative regulator of UBASH3B-dependent dephosphorylation. May inhibit dynamin-dependent endocytic pathways by functionally sequestering dynamin via its SH3 domain. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Protein phosphatase, tyrosine (non-receptor)

Chromosomal Location of Human Ortholog: 21q22.3

Cellular Component: nucleus; cytosol

Biological Process: negative regulation of T cell receptor signaling pathway; regulation of cytokine production

Similar Products

Product Notes

The UBASH3A ubash3a (Catalog #AAA6150315) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The UBASH3A (Ubiquitin-associated and SH3 Domain-containing Protein A, Cbl-interacting Protein 4, CLIP4, Suppressor of T-cell Receptor Signaling 2, STS2, STS-2, T-cell Ubiquitin Ligand 1, TULA-1, TULA) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's UBASH3A can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the UBASH3A ubash3a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "UBASH3A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.