Mouse anti-Human UBASH3A Monoclonal Antibody | anti-UBASH3A antibody

UBASH3A (Ubiquitin-associated and SH3 Domain-containing Protein A, Cbl-interacting Protein 4, CLIP4, Suppressor of T-cell Receptor Signaling 2, STS2, STS-2, T-cell Ubiquitin Ligand 1, TULA-1, TULA) (FITC)

Cat. Num. AAA6150315

• Reactivity: Human
• Applications: ELISA, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: UBASH3A; Monoclonal Antibody; UBASH3A (Ubiquitin-associated and SH3 Domain-containing Protein A; Cbl-interacting Protein 4; CLIP4; Suppressor of T-cell Receptor Signaling 2; STS2; STS-2; T-cell Ubiquitin Ligand 1; TULA-1; TULA) (FITC); anti-UBASH3A antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4D2
• Specificity: Recognizes human UBASH3A.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
• Sequence Length: 623

• Applicable Applications for anti-UBASH3A antibody: ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa524-624 from human UBASH3A (NP_001001895) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MDRCTASMVQIVNTCPQDTGVILIVSHGSTLDSCTRPLLGLPPRECGDFAQLVRKIPSLGMCFCEENKEEGKWELVNPPVKTLTHGANAAFNWRNWISGN
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Immunoprecipitation (IP)

(Immunoprecipitation of UBASH3A transfected lysate using UBASH3A monoclonal antibody and Protein A Magnetic Bead and immunoblotted with UBASH3A rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged UBASH3A is 0.3ng/ml as a capture antibody.)

Product Categories/Family for anti-UBASH3A antibody

Antibodies; Ubiquitin

NCBI and Uniprot Product Information

• NCBI GI #: 49640014
• NCBI Accession #: NP_001001895
• NCBI GenBank Nucleotide #: NM_001001895
• UniProt Accession #: P57075
• NCBI Official Full Name: ubiquitin-associated and SH3 domain-containing protein A isoform 2
• UniProt Protein Name: Ubiquitin-associated and SH3 domain-containing protein A
• Protein Family: Ubiquitin-associated and SH3 domain-containing protein
• UniProt Gene Name: UBASH3A
• UniProt Synonym Gene Names: STS2; CLIP4; STS-2; TULA-1
• UniProt Entry Name: UBS3A_HUMAN

Uniprot Description

STS2: Interferes with CBL-mediated down-regulation and degradation of receptor-type tyrosine kinases. Promotes accumulation of activated target receptors, such as T-cell receptors, EGFR and PDGFRB, on the cell surface. Exhibits negligigle protein tyrosine phosphatase activity at neutral pH. May act as a dominant-negative regulator of UBASH3B-dependent dephosphorylation. May inhibit dynamin-dependent endocytic pathways by functionally sequestering dynamin via its SH3 domain. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Protein phosphatase, tyrosine (non-receptor)

Chromosomal Location of Human Ortholog: 21q22.3

Cellular Component: nucleus; cytosol

Biological Process: negative regulation of T cell receptor signaling pathway; regulation of cytokine production