Mouse TWIST2 Monoclonal Antibody | anti-TWIST2 antibody

TWIST2 (Twist Homolog 2 (Drosophila), DERMO1, MGC117334, bHLHa39) (HRP)

Cat. Num. AAA6181636

• Gene Names: TWIST2; AMS; FFDD3; BBRSAY; DERMO1; SETLSS; bHLHa39
• Applications: ELISA, Immunofluorescence, Immunoprecipitation, Western Blot
• Purity: Purified
• Synonyms: TWIST2; Monoclonal Antibody; TWIST2 (Twist Homolog 2 (Drosophila); DERMO1; MGC117334; bHLHa39) (HRP); Twist Homolog 2 (Drosophila); bHLHa39; anti-TWIST2 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 100
• Specificity: Recognizes TWIST2.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 160

• Applicable Applications for anti-TWIST2 antibody: ELISA (EIA), Immunofluorescence (IF), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: TWIST2 (AAH33168, 1aa-160aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKSSEDGSPTPGKRGKKGSPSAQSFEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDEMDNKMTSCSYVAHERLSYAFSVWRMEGSWSMSASH
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of TWIST2 expression in transfected 293T cell line by TWIST2 monoclonal antibody (M06), clone 1E2.Lane 1: TWIST2 transfected lysate (18.1 KDa).Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of TWIST2 transfected lysate using anti-TWIST2 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with TWIST2 MaxPab rabbit polyclonal antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to TWIST2 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to TWIST2 on HeLa cell. [antibody concentration 10 ug/ml])

Product Categories/Family for anti-TWIST2 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 21620051
• NCBI GeneID: 117581
• NCBI Official Full Name: TWIST2 protein
• NCBI Official Synonym Full Names: twist family bHLH transcription factor 2
• NCBI Official Symbol: TWIST2
• NCBI Official Synonym Symbols: AMS; FFDD3; BBRSAY; DERMO1; SETLSS; bHLHa39
• NCBI Protein Information: twist-related protein 2
• Protein Family: Twist-related protein

NCBI Description

The protein encoded by this gene is a basic helix-loop-helix type transcription factor and shares similarity with Twist. This protein may inhibit osteoblast maturation and maintain cells in a preosteoblast phenotype during osteoblast development. This gene may be upregulated in certain cancers. Mutations in this gene cause focal facial dermal dysplasia 3, Setleis type. Two transcript variants encoding the same protein have been found. [provided by RefSeq, Apr 2014]