<
Western Blot (WB)
(Western Blot analysis of TWIST2 expression in transfected 293T cell line by TWIST2 monoclonal antibody (M06), clone 1E2.Lane 1: TWIST2 transfected lysate(18.1 KDa).Lane 2: Non-transfected lysate.)
Mouse TWIST2 Monoclonal Antibody | anti-TWIST2 antibody
TWIST2 (Twist Homolog 2 (Drosophila), DERMO1, MGC117334, bHLHa39) (APC)
Gene Names
TWIST2; AMS; FFDD3; BBRSAY; DERMO1; SETLSS; bHLHa39
Applications
ELISA, Immunofluorescence, Immunoprecipitation, Western Blot
Purity
Purified
Synonyms
TWIST2; Monoclonal Antibody; TWIST2 (Twist Homolog 2 (Drosophila); DERMO1; MGC117334; bHLHa39) (APC); Twist Homolog 2 (Drosophila); bHLHa39; anti-TWIST2 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
100
Specificity
Recognizes TWIST2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
160
Applicable Applications for anti-TWIST2 antibody
ELISA (EIA), Immunofluorescence (IF), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
TWIST2 (AAH33168, 1aa-160aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKSSEDGSPTPGKRGKKGSPSAQSFEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDEMDNKMTSCSYVAHERLSYAFSVWRMEGSWSMSASH
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of TWIST2 expression in transfected 293T cell line by TWIST2 monoclonal antibody (M06), clone 1E2.Lane 1: TWIST2 transfected lysate(18.1 KDa).Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of TWIST2 expression in transfected 293T cell line by TWIST2 monoclonal antibody (M06), clone 1E2.Lane 1: TWIST2 transfected lysate(18.1 KDa).Lane 2: Non-transfected lysate.)
Immunoprecipitation (IP)
(Immunoprecipitation of TWIST2 transfected lysate using anti-TWIST2 monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with TWIST2 MaxPab rabbit polyclonal antibody.)
Immunoprecipitation (IP)
(Immunoprecipitation of TWIST2 transfected lysate using anti-TWIST2 monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with TWIST2 MaxPab rabbit polyclonal antibody.)
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to TWIST2 on HeLa cell. [antibody concentration 10 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to TWIST2 on HeLa cell. [antibody concentration 10 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to TWIST2 on HeLa cell. [antibody concentration 10 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to TWIST2 on HeLa cell. [antibody concentration 10 ug/ml])
Related Product Information for anti-TWIST2 antibody
Basic helix-loop-helix (bHLH) transcription factors have been implicated in cell lineage determination and differentiation. The protein encoded by this gene is a bHLH transcription factor and shares similarity with another bHLH transcription factor, Twist. It is thought that during osteoblast development this protein may inhibit osteoblast maturation and maintain cells in a preosteoblast phenotype. [provided by RefSeq]
Product Categories/Family for anti-TWIST2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
TWIST2 protein
NCBI Official Synonym Full Names
twist family bHLH transcription factor 2
NCBI Official Symbol
TWIST2
NCBI Official Synonym Symbols
AMS; FFDD3; BBRSAY; DERMO1; SETLSS; bHLHa39
NCBI Protein Information
twist-related protein 2
Protein Family
NCBI Description
The protein encoded by this gene is a basic helix-loop-helix type transcription factor and shares similarity with Twist. This protein may inhibit osteoblast maturation and maintain cells in a preosteoblast phenotype during osteoblast development. This gene may be upregulated in certain cancers. Mutations in this gene cause focal facial dermal dysplasia 3, Setleis type. Two transcript variants encoding the same protein have been found. [provided by RefSeq, Apr 2014]
Research Articles on TWIST2
Similar Products
Product Notes
The TWIST2 (Catalog #AAA6168406) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's TWIST2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TWIST2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TWIST2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
