Mouse anti-Human, Rat Tumor Necrosis Factor Monoclonal Antibody | anti-TNF antibody

Tumor Necrosis Factor (TNF, TNF-alpha, TNFA, TNF-a, Cachectin, DIF, Tumor Necrosis Factor Ligand Superfamily Member 2, TNFSF2) APC

Cat. Num. AAA6139543

• Gene Names: TNF; DIF; TNFA; TNFSF2; TNLG1F; TNF-alpha
• Reactivity: Human, Rat
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: Tumor Necrosis Factor; Monoclonal Antibody; Tumor Necrosis Factor (TNF; TNF-alpha; TNFA; TNF-a; Cachectin; DIF; Tumor Necrosis Factor Ligand Superfamily Member 2; TNFSF2) APC; anti-TNF antibody

• Host: Mouse
• Reactivity: Human, Rat
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: M1-C4
• Specificity: Recognizes human TNF. Species Crossreactivity: rat.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-TNF antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 0.3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-234 from human TNF (AAH28148) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL*
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (51.74kD).)

Western Blot (WB)

(TNF monoclonal antibody. Western Blot analysis of TNF expression in rat liver.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to TNF on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged TNF is ~0.3ng/ml as a capture antibody.)

Product Categories/Family for anti-TNF antibody

Antibodies; Growth Factors; Cytokines

NCBI and Uniprot Product Information

• NCBI GI #: 20381341
• NCBI GeneID: 7124
• Molecular Weight: 25,644 Da
• NCBI Official Full Name: Homo sapiens tumor necrosis factor (TNF superfamily, member 2), mRNA
• NCBI Official Synonym Full Names: tumor necrosis factor
• NCBI Official Symbol: TNF
• NCBI Official Synonym Symbols: DIF; TNFA; TNFSF2; TNLG1F; TNF-alpha
• NCBI Protein Information: tumor necrosis factor
• Protein Family: Tumor necrosis factor

NCBI Description

This gene encodes a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. This cytokine is mainly secreted by macrophages. It can bind to, and thus functions through its receptors TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. This cytokine is involved in the regulation of a wide spectrum of biological processes including cell proliferation, differentiation, apoptosis, lipid metabolism, and coagulation. This cytokine has been implicated in a variety of diseases, including autoimmune diseases, insulin resistance, and cancer. Knockout studies in mice also suggested the neuroprotective function of this cytokine. [provided by RefSeq, Jul 2008]