Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human, Rat TSSC1 Monoclonal Antibody | anti-TSSC1 antibody

TSSC1 (Tumor-suppressing Subchromosomal Transferable Fragment Candidate Gene 1 Protein, Tumor-suppressing STF cDNA 1 Protein, Protein TSSC1) (FITC)

Gene Names
EIPR1; TSSC1; EIPR-1
Reactivity
Human, Rat
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TSSC1; Monoclonal Antibody; TSSC1 (Tumor-suppressing Subchromosomal Transferable Fragment Candidate Gene 1 Protein; Tumor-suppressing STF cDNA 1 Protein; Protein TSSC1) (FITC); anti-TSSC1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2H5
Specificity
Recognizes human TSSC1. Species Crossreactivity: rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
1657
Applicable Applications for anti-TSSC1 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa288-387 from human TSSC1 (NP_003301) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VLTGSSDSRVILSNMVSISSEPFGHLVDDDDISDQEDHRSEEKSKEPLQDNVIATYEEHEDSVYAVDWSSADPWLFASLSYDGRLVINRVPRALKYHILL
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(TSSC1 monoclonal antibody. Western Blot analysis of TSSC1 expression in PC-12.)

Western Blot (WB) (TSSC1 monoclonal antibody. Western Blot analysis of TSSC1 expression in PC-12.)

Western Blot (WB)

(Western Blot analysis of TSSC1 expression in transfected 293T cell line by TSSC1 monoclonal antibody. Lane 1: TSSC1 transfected lysate (Predicted MW: 43.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of TSSC1 expression in transfected 293T cell line by TSSC1 monoclonal antibody. Lane 1: TSSC1 transfected lysate (Predicted MW: 43.6kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to TSSC1 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to TSSC1 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged TSSC1 is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged TSSC1 is ~1ng/ml as a capture antibody.)
Product Categories/Family for anti-TSSC1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens EARP complex and GARP complex interacting protein 1 (EIPR1), transcript variant 2, mRNA
NCBI Official Synonym Full Names
EARP complex and GARP complex interacting protein 1
NCBI Official Symbol
EIPR1
NCBI Official Synonym Symbols
TSSC1; EIPR-1
NCBI Protein Information
EARP and GARP complex-interacting protein 1
UniProt Protein Name
Protein TSSC1
Protein Family
UniProt Gene Name
TSSC1
UniProt Entry Name
TSSC1_HUMAN

NCBI Description

This gene has been reported in PMID 9403053 as one of several tumor-suppressing subtransferable fragments located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. Alignment of this gene to genomic sequence data suggests that this gene resides on chromosome 2 rather than chromosome 11. [provided by RefSeq, Dec 2008]

Uniprot Description

TSSC1:

Chromosomal Location of Human Ortholog: 2p25.3

Research Articles on TSSC1

Similar Products

Product Notes

The TSSC1 tssc1 (Catalog #AAA6150267) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TSSC1 (Tumor-suppressing Subchromosomal Transferable Fragment Candidate Gene 1 Protein, Tumor-suppressing STF cDNA 1 Protein, Protein TSSC1) (FITC) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TSSC1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TSSC1 tssc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TSSC1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.