Mouse anti-Human TSC22D1 Monoclonal Antibody | anti-TSC22D1 antibody

TSC22D1 (TSC22 Domain Family Protein 1, Cerebral Protein 2, hucep-2, KIAA1994, MGC17597, Regulatory Protein TSC-22, TGFB-stimulated Clone 22 Homolog, Transforming Growth Factor beta-1-induced Transcript 4 Protein, TGFB1I4, TSC22, DKFZp686O19206, MGC17597,

Cat. Num. AAA6144949

• Gene Names: TSC22D1; Ptg-2; TSC22; TGFB1I4
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: TSC22D1; Monoclonal Antibody; TSC22D1 (TSC22 Domain Family Protein 1; Cerebral Protein 2; hucep-2; KIAA1994; MGC17597; Regulatory Protein TSC-22; TGFB-stimulated Clone 22 Homolog; Transforming Growth Factor beta-1-induced Transcript 4 Protein; TGFB1I4; TSC22; DKFZp686O19206; ; anti-TSC22D1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1G7
• Specificity: Recognizes human TSC22D1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-TSC22D1 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-145 from TSC22D1 (AAH00456) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MKSQWCRPVAMDLGVYQLRHFSISFLSSLLGTENASVRLDNSSSGASVVAIDNKIEQAMDLVKSHLMYAVREEVEVLKEQIKELIEKNSQLEQENNLLKTLASPEQLAQFQAQLQTGSPPATTQPQGTTQPPAQPASQGSGPTA
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged TSC22D1 is 0.03ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to TSC22D1 on HeLa cell. [antibody concentration 10ug/ml].)

Western Blot (WB)

(Western Blot analysis of TSC22D1 expression in transfected 293T cell line by TSC22D1 monoclonal antibody Lane 1: TSC22D1 transfected lysate (15.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB)

(Western Blot detection against Immunogen (41.95kD).)

Product Categories/Family for anti-TSC22D1 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 33875469
• NCBI GeneID: 8848
• Molecular Weight: 58,859 Da
• NCBI Official Full Name: Homo sapiens TSC22 domain family, member 1, mRNA
• NCBI Official Synonym Full Names: TSC22 domain family member 1
• NCBI Official Symbol: TSC22D1
• NCBI Official Synonym Symbols: Ptg-2; TSC22; TGFB1I4
• NCBI Protein Information: TSC22 domain family protein 1
• Protein Family: TSC22 domain family protein

NCBI Description

This gene encodes a member of the TSC22 domain family of leucine zipper transcription factors. The encoded protein is stimulated by transforming growth factor beta, and regulates the transcription of multiple genes including C-type natriuretic peptide. The encoded protein may play a critical role in tumor suppression through the induction of cancer cell apoptosis, and a single nucleotide polymorphism in the promoter of this gene has been associated with diabetic nephropathy. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Aug 2011]