Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (TSC22D1 rabbit polyclonal antibody. Western Blot analysis of TSC22D1 expression in Hela NE.)

Rabbit anti-Human TSC22D1 Polyclonal Antibody | anti-TSC22D1 antibody

TSC22D1 (TSC22 Domain Family Protein 1, Cerebral Protein 2, hucep-2, KIAA1994, MGC17597, Regulatory Protein TSC-22, TGFB-stimulated Clone 22 Homolog, Transforming Growth Factor beta-1-induced Transcript 4 Protein, TGFB1I4, TSC22, DKFZp686O19206, MGC17597,

Gene Names
TSC22D1; Ptg-2; TSC22; TGFB1I4
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TSC22D1; Polyclonal Antibody; TSC22D1 (TSC22 Domain Family Protein 1; Cerebral Protein 2; hucep-2; KIAA1994; MGC17597; Regulatory Protein TSC-22; TGFB-stimulated Clone 22 Homolog; Transforming Growth Factor beta-1-induced Transcript 4 Protein; TGFB1I4; TSC22; DKFZp686O19206; ; anti-TSC22D1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human TSC22D1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-TSC22D1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human TSC22D1, aa1-144 (NP_006013.1).
Immunogen Sequence
MKSQWCRPVAMDLGVYQLRHFSISFLSSLLGTENASVRLDNSSSGASVVAIDNKIEQAMDLVKSHLMYAVREEVEVLKEQIKELIEKNSQLEQENNLLKTLASPEQLAQFQAQLQTGSPPATTQPQGTTQPPAQPASQGSGPTA
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(TSC22D1 rabbit polyclonal antibody. Western Blot analysis of TSC22D1 expression in Hela NE.)

Western Blot (WB) (TSC22D1 rabbit polyclonal antibody. Western Blot analysis of TSC22D1 expression in Hela NE.)

Western Blot (WB)

(Western Blot analysis of TSC22D1 expression in transfected 293T cell line by TSC22D1 polyclonal antibody. Lane 1: TSC22D1 transfected lysate (15.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of TSC22D1 expression in transfected 293T cell line by TSC22D1 polyclonal antibody. Lane 1: TSC22D1 transfected lysate (15.7kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-TSC22D1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58,859 Da
NCBI Official Full Name
TSC22 domain family protein 1 isoform 2
NCBI Official Synonym Full Names
TSC22 domain family, member 1
NCBI Official Symbol
TSC22D1
NCBI Official Synonym Symbols
Ptg-2; TSC22; TGFB1I4
NCBI Protein Information
TSC22 domain family protein 1; cerebral protein 2; regulatory protein TSC-22; TGFbeta-stimulated clone 22; TGFB-stimulated clone 22 homolog; transcriptional regulator TSC-22; transforming growth factor beta-stimulated protein TSC-22; transforming growth f
UniProt Protein Name
TSC22 domain family protein 1
UniProt Gene Name
TSC22D1
UniProt Synonym Gene Names
KIAA1994; TGFB1I4; TSC22
UniProt Entry Name
T22D1_HUMAN

NCBI Description

This gene encodes a member of the TSC22 domain family of leucine zipper transcription factors. The encoded protein is stimulated by transforming growth factor beta, and regulates the transcription of multiple genes including C-type natriuretic peptide. The encoded protein may play a critical role in tumor suppression through the induction of cancer cell apoptosis, and a single nucleotide polymorphism in the promoter of this gene has been associated with diabetic nephropathy. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Aug 2011]

Uniprot Description

TSC22D1: Transcriptional repressor. Acts on the C-type natriuretic peptide (CNP) promoter. Belongs to the TSC-22/Dip/Bun family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 13q14

Cellular Component: cytoplasm; nucleus

Molecular Function: protein binding; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; regulation of transcription, DNA-dependent; positive regulation of apoptosis; positive regulation of cell proliferation; negative regulation of apoptosis

Research Articles on TSC22D1

Similar Products

Product Notes

The TSC22D1 tsc22d1 (Catalog #AAA6397359) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TSC22D1 (TSC22 Domain Family Protein 1, Cerebral Protein 2, hucep-2, KIAA1994, MGC17597, Regulatory Protein TSC-22, TGFB-stimulated Clone 22 Homolog, Transforming Growth Factor beta-1-induced Transcript 4 Protein, TGFB1I4, TSC22, DKFZp686O19206, MGC17597, reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TSC22D1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TSC22D1 tsc22d1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TSC22D1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.