Testing Data
(Detection limit for recombinant GST tagged TRPC4AP is ~0.03ng/ml as a capture antibody.)
Mouse anti-Human TRPC4AP Monoclonal Antibody | anti-TRPC4AP antibody
TRPC4AP (Short Transient Receptor Potential Channel 4-associated Protein, Trp4-associated Protein, Trpc4-associated Protein, TRRP4AP, Protein TAP1, TNF-receptor Ubiquitous Scaffolding/signaling Protein, Protein TRUSS, C20orf188) (HRP)
Gene Names
TRPC4AP; TRUSS; TRRP4AP; PPP1R158; C20orf188
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TRPC4AP; Monoclonal Antibody; TRPC4AP (Short Transient Receptor Potential Channel 4-associated Protein; Trp4-associated Protein; Trpc4-associated Protein; TRRP4AP; Protein TAP1; TNF-receptor Ubiquitous Scaffolding/signaling Protein; Protein TRUSS; C20orf188) (HRP); anti-TRPC4AP antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3G4
Specificity
Recognizes human TRPC4AP.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-TRPC4AP antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa341-452 from human TRPC4AP (NP_056453) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VANEESEHNQASIVFPPPGASEENGLPHTSARTQLPQSMKIMHEIMYKLEVLYVLCVLLMGRQRNQVHRMIAEFKLIPGLNNLFDKLIWRKHSASALVLHGHNQNCDCSPD*
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged TRPC4AP is ~0.03ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged TRPC4AP is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-TRPC4AP antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
90,043 Da
NCBI Official Full Name
short transient receptor potential channel 4-associated protein isoform a
NCBI Official Synonym Full Names
transient receptor potential cation channel, subfamily C, member 4 associated protein
NCBI Official Symbol
TRPC4AP
NCBI Official Synonym Symbols
TRUSS; TRRP4AP; PPP1R158; C20orf188
NCBI Protein Information
short transient receptor potential channel 4-associated protein; TNF-receptor ubiquitous scaffolding/signaling protein; TRP4-associated protein; protein phosphatase 1, regulatory subunit 158; short transient receptor potential channel 4 associated protein
UniProt Protein Name
Short transient receptor potential channel 4-associated protein
UniProt Gene Name
TRPC4AP
UniProt Synonym Gene Names
C20orf188; TRRP4AP; Trp4-associated protein; Trpc4-associated protein; Protein TRUSS
UniProt Entry Name
TP4AP_HUMAN
Similar Products
Product Notes
The TRPC4AP trpc4ap (Catalog #AAA6155551) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TRPC4AP (Short Transient Receptor Potential Channel 4-associated Protein, Trp4-associated Protein, Trpc4-associated Protein, TRRP4AP, Protein TAP1, TNF-receptor Ubiquitous Scaffolding/signaling Protein, Protein TRUSS, C20orf188) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TRPC4AP can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TRPC4AP trpc4ap for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TRPC4AP, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
